KEGG   Enterobacter sp. R4-368: H650_15245Help
Entry
H650_15245        CDS       T02700                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
enr  Enterobacter sp. R4-368
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:enr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    H650_15245
Enzymes [BR:enr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     H650_15245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3025525..3026550
Genome map
AA seq 341 aa AA seqDB search
MEGAIPPLEGQYKKEKHGTRHRKVAHFTDKLIMKTAGKLVVLGSINADHILNLESFPTPG
ETVTGSQYQVAFGGKGANQAVAAGRSGADIAFIACTGDDDTGARVRKQLESDNIDVAPVS
VVAGESTGVALIFVNGEGENVIGIHAGANAALSIDRVNSQHDLIAQASALLMQLESPVES
VLAAARIAHQNNTTVALNPAPARQLSDDLLALVDIITPNETEAEKLTGIKVSSDEDAARA
AQALHAKGIKTVIITLGSRGVWASVNGEGKRVPGFKVKAIDTIAAGDTFNGALLTALLED
KPLDEAIRFAHAAAAIAVTRKGAQPSVPWRNEIDDFLSSQR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtggagggcgcaatcccgccactggagggacaatacaaaaaagaaaagcatggcacgcgc
caccgaaaggtggcgcattttacggacaagctcatcatgaaaaccgcaggcaaactcgtt
gtccttggcagtatcaatgccgatcacattcttaaccttgaatctttccctactccgggc
gaaaccgtgacgggcagccagtatcaggtggcttttggcggtaaaggggcaaaccaggcg
gtagctgccgggcgtagcggtgcggatattgcgtttatcgcctgtaccggcgatgacgat
accggtgcgcgcgtgcgtaaacagcttgagagcgacaatattgatgttgcgccggtgagc
gttgtcgcgggcgaatccacaggtgttgcgctgattttcgtcaacggtgaaggtgagaat
gttatcggtattcatgcgggagcgaatgcggcgctctcaattgatcgcgtcaactcgcag
catgacctgattgcgcaggcttctgcgctgttaatgcaactggaatcaccggttgaaagc
gtactggctgcggcgcgtattgcgcatcagaacaataccaccgtggcgctgaatccggca
ccggcgcgccagctttccgatgacctgctggcgctggtggatatcatcacgccaaatgag
accgaagcggaaaaactcaccggaattaaggtgtccagcgacgaagacgccgcgcgggct
gcacaggcgctgcacgccaaaggtattaaaacggtgatcattactctcggtagccgtggt
gtctgggccagcgttaatggcgaaggcaaacgcgtaccgggctttaaagtgaaagccatc
gacaccattgcggcgggtgacacgtttaacggcgcgttgctgaccgcgctactggaagat
aaacctctggatgaggcgattcgttttgctcatgcggcggcggcgattgccgtcacgcgt
aagggtgcgcaaccgtctgtgccgtggcgcaacgagattgacgattttctctcttcgcag
aggtga

DBGET integrated database retrieval system