KEGG   Enterobacter sp. R4-368: H650_20180Help
Entry
H650_20180        CDS       T02700                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
enr  Enterobacter sp. R4-368
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:enr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    H650_20180
  Amino acid metabolism
   00330 Arginine and proline metabolism
    H650_20180
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    H650_20180
Enzymes [BR:enr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     H650_20180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4084382..4085485
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQQHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLTRADMEDRERFLNARDT
LRALLDNNIVPVINENDAVATTEIKVGDNDNLSALAAILAGADKLLLLTDQQGLFTADPR
SNPDAELIKDVYGIDDALRAIAGDSVSGLGTGGMGTKLQAADVACRAGIDTIIAAGSKPG
VIGDVVEGISVGTRFHAQESPLENRKRWIFGAPPAGEITVDEGATAAILERGSSLLPKGI
KSVTGNFSRGEVIRIRNLQGRDIAHGVSRYNSDALRRIAGQHSQQIDAILGYEYGPVAVH
RDDMITR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtggtaaaactcggtaccagtgttttaacgggcggttcc
cgtcgcctgaaccgcgcccatattgttgaactggtgcgccagtgcgcacagcaacacgcc
gccgggcatagaattgtaattgtgacgtctggcgcgattgccgccggacgcgagcatctg
ggctacccggaactccccgcgactatcgcgtcgaaacagctgctggcggcggtagggcag
agccgtttgattcaactgtgggaacaactattttccatttacgggattcatattgggcag
atgctgctgacgcgcgccgatatggaagatcgtgagcgtttcctcaatgcgcgcgacacg
ctgcgtgcgctgctcgacaacaatatcgtgccggtgattaacgaaaacgacgccgtagcc
accacggaaatcaaagtcggcgataacgataacctctccgcgctcgccgctatccttgcc
ggtgccgacaaactgctactgctgaccgatcagcaaggcctgtttaccgccgatccgcgt
agcaacccggacgcggaactgattaaagacgtttacggcatcgacgatgcgctgcgcgcg
attgccggggacagcgtttccggcctcggtacgggcgggatgggcaccaagctgcaagcg
gctgacgttgcctgccgcgcggggatcgacaccattatcgctgcgggcagcaagccaggc
gtgattggcgatgttgtggaagggatttccgtcggcacgcgctttcacgcccaggagtcg
ccgctggaaaaccgtaaacgctggatctttggcgcgccgcctgccggtgaaatcaccgtt
gatgaaggcgcaacggcggccattctggaacgcggcagctccttgttgcccaaaggcatt
aaaagcgtgacaggcaacttttcccgtggtgaagtgatccgcattcgtaatctgcaaggt
cgcgatatcgcccacggcgtaagccgttataacagcgatgcgctgcgtcgcattgccggg
caacattcgcagcagattgacgccattctgggctacgaatatggccctgtcgcggtgcac
cgcgacgacatgattacccgttaa

DBGET integrated database retrieval system