KEGG   Enterobacter sp. 638: Ent638_0036Help
Entry
Ent638_0036       CDS       T00507                                 

Definition
Beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ent  Enterobacter sp. 638
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ent638_0036
Enzymes [BR:ent01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Ent638_0036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(39580..40968)
Genome map
AA seq 462 aa AA seqDB search
MKYSFPDNFWWGSASSALQTEGESQGGGKGLTTWDHWFANEPNRFHQGVGPQDTSTFCQN
WKADIQLLKQLNHNSFRTSISWARLIPDGVGEVNPQAVDFYNQVFDELLEQGITPFITLF
HFDMPMAMQEIGGWENRDVVAAYSRYAQICFELFGDRVLHWFTFNEPIVPVEGGYLYDFH
YPNVVDFRRAATVAYNTVLAHAQAVRAFRAGHFPGEIGIVLNLTPSYPRSQNPQDVKAAH
YADLMFNRSFLDPVLRGEYPADLVALLKSYEQLPACQPDDSAVIAEGTIDLLGINYYQPR
RVKCRDSAVNPKAPFMPEWFFDNYEMPGRKMNPYRGWEIYEPGIYDILVNLRENYGNPRC
FISENGMGVENEQRFIENGQINDQYRIDFISEHLKWVHKGISEGSNCLGYHMWTFIDNWS
WCNAYKNRYGFIQLDLATQKRTIKKSGEWFAATSLNNSFDKE
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattcatttcccgataacttttggtggggcagcgcaagctctgcgttgcagacc
gaaggggaaagccagggcggcggcaagggactgaccacctgggatcactggttcgccaat
gagccaaaccgttttcaccagggcgtggggccgcaggatacctcaacgttctgtcagaac
tggaaagcggacattcagctgttgaaacagctgaaccataacagctttcgcacctcgatt
agctgggcgcgtctgatccccgacggtgtcggcgaagtgaatccgcaggcggtggacttt
tacaatcaggtgttcgacgagctgcttgagcagggcattacaccgttcatcaccctgttc
cacttcgacatgccgatggcgatgcaggagattggcggctgggaaaaccgtgacgtcgtg
gcggcgtattcccgctacgcgcagatttgctttgagctgtttggcgatcgcgtgctgcac
tggtttaccttcaacgagccgattgtgccggtagaaggcggttatctttacgacttccat
tatccgaacgtggtggatttccgtcgtgcggcgaccgtcgcgtacaacacggtgctggct
catgcgcaggcggttcgcgccttccgcgccgggcattttcccggtgaaattggcatcgtg
ctgaacctgacgccgtcgtatccgcggtcgcaaaacccgcaggatgtgaaagccgcgcac
tatgcggacctgatgtttaaccgcagcttcctcgatccggtgctgcgtggtgaatatccg
gccgatttggtcgcgctgttgaagtcctacgagcagcttcctgcctgtcagcctgacgac
agcgcggtgattgcggaaggcaccatcgatttgctgggcattaactactatcagccgcgt
cgcgtgaaatgtcgtgacagcgcggtgaatcctaaggcgccgtttatgccggagtggttc
tttgataattacgaaatgccaggccgtaaaatgaatccgtaccgtggctgggaaatctac
gagccgggtatttacgatattctcgttaatctgcgggaaaattacggcaacccacgctgc
tttatttctgaaaatggtatgggtgtcgaaaacgagcagcgttttattgaaaacggtcaa
attaacgatcagtatcgtatcgactttatttccgaacatcttaaatgggtacacaaaggt
attagcgaaggcagtaactgtcttggctaccatatgtggacatttattgataactggtca
tggtgtaatgcgtataaaaaccgctacggctttattcagctggatctggcgacgcagaaa
cgcaccattaagaaaagtggagaatggtttgctgccacttctctgaataatagttttgat
aaagagtaa

DBGET integrated database retrieval system