KEGG   Enterobacter sp. 638: Ent638_0218Help
Entry
Ent638_0218       CDS       T00507                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ent  Enterobacter sp. 638
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ent638_0218
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ent638_0218
   00630 Glyoxylate and dicarboxylate metabolism
    Ent638_0218
Enzymes [BR:ent01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Ent638_0218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
257347..258948
Genome map
AA seq 533 aa AA seqDB search
MTQQATTADELAFNQPHGEQEKQILTPEAVEFLAELVTRFAPKRHTLLAARIQQQQDIDN
GKLPDFISETASIRESDWRIRGIPQDLQDRRVEITGPVERKMVINAMNANVKVFMADFED
SLAPNWRKVIEGQINLRDAVNGTISYTNEAGKIYQLKPDPAVLICRVRGLHLPEKHVTWR
GEPIPGSLFDFALYFFHNYQNLLAKGSGPYFYLPKTQSWQEAAWWSEVFSYAEDRFDLPR
GTIKATLLIETLPAVFQMDEILHALRDHITGLNCGRWDYIFSYIKTLKNHPDRVLPDRQA
VTMDKPFLNAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNHQVLSKVKADKELEAHNG
HDGTWIAHPGLADTAMEVFSRTLGDNQNQLSVSREDDAPITAEQLLAPCEGERTEAGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKSLFR
QMLGEELMTIQDELGEHRFSSGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacaggcaacgacagcagacgaactggcctttaatcagccacacggagagcag
gaaaaacagattttgacgccagaggctgtcgaatttctcgctgagctggtcacgcgcttc
gcgccaaagcgtcatacgctgctggcggcgcgcattcagcaacagcaggatattgataac
ggcaagctgcctgactttatttcggaaaccgcttccattcgtgagtcagactggagaatt
cgcggtattcctcaagatttgcaggatcgtcgcgttgaaatcaccggcccggttgagcgc
aaaatggtgattaacgccatgaatgccaacgttaaagtatttatggcggacttcgaagat
tcgctcgcaccaaactggcgcaaagtgatcgaaggccagatcaacctgcgcgatgcggtt
aatggcacgatcagctacaccaacgaagccgggaaaatctaccagctcaagccggatcct
gccgtcttaatctgccgcgtacgtggcttacatctgcctgaaaaacacgttacctggcgt
ggcgaaccgattcccggcagcctgtttgattttgcattgtacttcttccacaactatcaa
aacctgctggcaaaaggcagtggtccctatttttatctgccaaaaacccagtcctggcag
gaagcggcctggtggagtgaagtgtttagctatgcggaagatcgctttgatttgccgcgc
ggcaccatcaaagccacgctgttgattgaaaccttgccggcggtattccagatggatgag
atcctgcacgccttgcgcgatcacatcactggcctcaactgtgggcgctgggactacatt
ttcagctacatcaaaaccctgaaaaatcatcctgaccgtgtcttacccgaccgtcaggca
gtcacgatggataagcctttcctgaacgcttactcgcgcttactgattaaaacctgccac
aagcgcggtgcattcgcgatgggcggaatggctgcgtttattccgagcaaagacgccgag
cgcaaccatcaggtgctgagcaaagtgaaggcggacaaagagctggaagcccataacggt
cacgacggcacgtggattgcccatccaggccttgcggacaccgcaatggaagtcttcagc
cggacattaggcgataaccagaatcagctttccgtcagccgggaagacgacgcccctatc
accgcagagcaactcctggcgccctgcgaaggcgaacgtactgaagcaggtatgcgcgca
aatattcgtgtcgccgtgcagtacatcgaagcgtggatttcgggtaacggctgcgtaccg
atttacggtctgatggaagatgccgcgacggccgagatttcccggacctctatctggcaa
tggatccatcaccagaagaccctcagcaacggcaaaccggtaacgaaatcgctgttccgc
cagatgctgggcgaagagttgatgactatccaggacgagctaggcgaacaccgctttagc
agcggtcgtttcgacgacgccgcgcgtctgatggaacaaatcaccacctcagacgaatta
atcgacttcctcactctgccaggttatcgcctgcttgcataa

DBGET integrated database retrieval system