KEGG   Enterobacter sp. 638: Ent638_0315Help
Entry
Ent638_0315       CDS       T00507                                 

Definition
proline/glycine betaine transporter
Orthology
K03762  
MFS transporter, MHS family, proline/betaine transporter
Organism
ent  Enterobacter sp. 638
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
362615..364117
Genome map
AA seq 500 aa AA seqDB search
MLKRKKVKPITLRDVTIIDDGKLRKAITAASLGNAMEWFDFGVYGFVAYALGKVFFPGAD
PSLQMIAALGTFSVPFLIRPLGGLFFGMLGDKYGRQKILAITIVIMSISTFCIGLIPSYA
TIGIWAPILLLLCKMAQGFSVGGEYTGASIFVAEYSPDRKRGFMGSWLDFGSIAGFVLGA
GVVVLISTVVGEANFLEWGWRIPFFLALPLGLIGLYLRHALEETPAFQQHVEKLEQGDRE
GLQEGPKVSFKEIATKHWRSLLTCVGLVISTNVTYYMLLTYMPSYLSHNLHYSEDHGVLI
IIAIMVGMLFVQPIMGLLSDRYGRRPFIILGSVALLLLAIPAFILINSNVLGLIFAGLLM
LAVILNCFIGVMASTLPAMFPTHIRYSALAAAFNISVLVAGLTPTIAASLVESTQNLMMP
AYYLMVIAVIGLITGLTMKETANQPLKGATPAASDLQEAKEILREHYDNVEQKIDDLDVE
IEELQKKRSRLVDQHPRINE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaaggaaaaaagtcaaacccattacactgcgcgacgtcactatcattgatgac
ggcaagttgcgtaaagccattaccgctgcgtcgctgggtaacgcgatggagtggtttgat
ttcggtgtgtatggtttcgttgcctacgctttaggtaaagtcttcttcccgggtgccgac
ccgagcctgcagatgatcgcggctttaggtaccttctccgtacccttcctgattcgcccg
ctgggtggtttattcttcgggatgctgggcgacaaatacggtcgccagaagatactcgcc
atcacgattgtgatcatgtcgatcagtacattctgtatcggcttgattccgtcctatgcg
acgattggcatctgggcaccgatactgctgctgctgtgtaaaatggcgcagggcttctcg
gtcggtggtgaatataccggtgcatcgatctttgtcgccgagtattctccggaccgtaaa
cgcggcttcatgggaagctggctggactttggctcgattgccgggtttgtgctgggtgcg
ggcgtcgtggtgctcatttccaccgtcgtcggcgaagcgaacttccttgaatggggctgg
cgtattccgttcttcctggcgctgccgctgggtctgattggtctatacctgcgtcatgcg
ttagaagagacgccagcgttccagcagcatgttgaaaaactggagcagggcgatcgcgaa
gggctgcaggaaggaccgaaagtctcctttaaagagattgcgacgaaacactggcgtagc
ctgctgacctgtgtcggtctggtcatctcgaccaacgtgacctactacatgttgctgacc
tacatgccgagctacctgtcgcataacctgcattactccgaagatcacggtgtgctgatt
attatcgccatcatggtggggatgctgtttgtgcagccgattatgggcctgctgagtgac
cgctacggtcgccgtccgttcattattctgggcagcgttgcgctcttactactggcgatc
ccggcctttatcctgattaacagtaacgtgctgggcctgattttcgccggtctgctgatg
ctggcggtgattctgaactgctttatcggggtgatggcgtcaacgcttccggcgatgttc
ccgacgcatattcgctacagcgcgctggcggcagcgtttaacatttcggtgctggttgcc
ggtctgacgccgaccattgcggcctcgctggtcgaaagcacgcagaacctgatgatgcct
gcgtactatctgatggtgattgcggtgattggtttgattaccggtctgacaatgaaagag
accgcgaatcagccactgaaaggggccacgcctgcggcgtctgaccttcaggaagcgaaa
gagattctgcgtgaacactacgacaatgttgagcagaagattgacgatcttgacgtagag
attgaagagctgcagaagaagcgctctcgtctggtggatcagcatccacgcattaacgag
taa

DBGET integrated database retrieval system