KEGG   Enterobacter sp. 638: Ent638_0393Help
Entry
Ent638_0393       CDS       T00507                                 

Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ent  Enterobacter sp. 638
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Ent638_0393
Enzymes [BR:ent01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Ent638_0393
Transfer RNA biogenesis [BR:ent03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Ent638_0393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
444049..444789
Genome map
AA seq 246 aa AA seqDB search
MLEKICQLAREAGEAIMQVYDGAKPMDVVSKADDSPVTAADLAAHAVILKGLQALTPDIP
VLSEEDPQSWDVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIEMGKAVLGVVYAPVM
KVMYSAAEGKAWKEECGVRKQIQVRDARPPLVVISRSHSDNELQEYLQQIGEHQTTSIGS
SLKFCLVAEGQAQLYPRFGPTNVWDTAAGHAVAAAAGAHVHDWQGKPLDYTPRESFLNPG
FRVSLY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaaaaatttgtcagctcgcacgggaagccggtgaggccatcatgcaagtatac
gatggcgcaaagccgatggacgtggtcagcaaagctgacgactccccggtgaccgccgcc
gatcttgctgcccatgcggtgatcctcaaaggcttgcaggcactgacgccggatatccct
gtcctgtcggaagaagacccgcaaagctgggacgtacgccagcactggcagcgctactgg
ctggtcgatccgctggatggtacgaaagagttcatcaagcgcaacggcgagttcacggtc
aatattgccttgattgaaatgggcaaagcggtgctgggcgtggtgtacgcgcccgtgatg
aaagtgatgtacagcgccgcagaaggcaaagcgtggaaagaagagtgcggcgttcgcaaa
cagattcaagtgcgtgatgctcgcccgccgctggtggtcatcagtcgctcgcatagcgac
aacgaactgcaggagtatctgcaacagattggtgagcatcagacaacatcaatcggttcg
tcacttaaattctgcctggtagcagaagggcaggcccagctgtatccgcgatttgggccg
accaacgtctgggataccgcagcgggtcacgccgtagcggccgccgctggggcgcatgtt
cacgactggcagggcaagccactggactacaccccgcgcgagtcgttcttaaatccgggc
ttcagggtctcgctttattga

DBGET integrated database retrieval system