KEGG   Enterobacter sp. 638: Ent638_0542Help
Entry
Ent638_0542       CDS       T00507                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ent  Enterobacter sp. 638
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ent638_0542 (deoA)
Enzymes [BR:ent01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Ent638_0542 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
608146..609468
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSIPERVSLT
MAMRDSGSVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT
GGTLDKLEAIPGFDIFPNDTRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTFELSAALAEAIVGVSNGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAKDDAEARAKL
QAVLDNGKAAEIFGRMVAAQKGPNDFVENYAKYLPTAMLSKAVYADTEGFVSAMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTDMARLGDSVDGQRPLAVIHAKDENSWQEAAKAVKAA
IQLDDKAPETTPTVYRRITD
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgcattaagtgacgaa
gagatccgtttctttatcaacggcattcgtgacaacaccatctctgaagggcaaattgcc
gccctggcgatgaccatcttcttccacgatatgtcgataccggaacgcgtatcgctgacc
atggcgatgcgggattcaggtagcgttctggactggaaaagcctcaatcttaacggcccg
atcgtggacaaacactccacgggcggcgtaggcgatgtcacctctctgatgctcggccca
atggtcgcagcatgcggcggttacatcccgatgatctccgggcgcggcctgggtcacacg
ggcggtacgctcgacaaactggaagccattccgggcttcgatatcttcccgaacgacacg
cgttttcgcgaaattattaaagatgttggtgtggcgattatcggccagaccagctctctg
gctccggcggacaagcgtttctacgcaacacgcgatattaccgcgacggttgattccatc
ccgctgatcaccgcttcaatcctggcgaaaaaactggccgaagggctggatgcgctggtg
atggacgtgaaagtgggcagcggtgcatttatgccgacgtttgaactttctgcggcactg
gctgaagcgatcgttggcgtctccaacggcgcgggcgtgcgtaccacggcactgctgact
gacatgaatcaggtgctggcgtccagcgccggtaacgcggttgaagtccgtgaagcggtg
cagttcctgacgggcgaataccgtaatccgcgtctgttcgacgtcaccatggcgctgtgc
gttgagatgctcatctccggcaagctggccaaagacgacgccgaagcgcgtgcgaaattg
caggccgtgctggataacggtaaagcggcagagatctttggccgcatggtcgctgcgcaa
aaaggcccgaacgatttcgttgagaactatgcgaaatacctgccgaccgccatgctcagc
aaagcggtgtatgccgatacagaaggttttgtctccgcaatggacacccgtgcgctcggc
atggcagtggtatcgatgggcggcggtcgtcgccaggcgtcggacaccattgattacagc
gttggctttaccgatatggcacgtctgggcgacagcgttgacggacagcgtccgttagcc
gttatccatgcgaaggacgaaaacagctggcaggaagcggcgaaagcggtgaaagcggcc
attcagcttgacgacaaagcaccagaaaccacaccaacggtctatcgtcgtatcaccgat
tag

DBGET integrated database retrieval system