KEGG   Enterobacter sp. 638: Ent638_0566Help
Entry
Ent638_0566       CDS       T00507                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ent  Enterobacter sp. 638
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ent638_0566
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ent638_0566
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ent638_0566
Enzymes [BR:ent01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ent638_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
636325..637611
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKQDFVSRSAKIVS
AFIGDEIPQAELEERVRAAFTFPAPVKSVEPDIGCLELFHGPTLAFKDFGGRFMAQMLTH
ISGDKPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPQGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLKEGKWTPNATKATLSNA
MDVSQPNNWPRVEELFRRKIWRLSDLGYAAVTDETTKATMRELKAVGYISEPHAAIAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVDEILGESLPLPKELADRADLPLLSHSLPAEFAAL
RKLMMTRG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacaatctgaaagatcataacgagcaggtcagcttcgcgcaggcggtgact
cagggcctgggcaaaaatcaggggttgttctttccgcacgacttgccggaatttagcctg
accgaaatcgatgaaatgctgaagcaggattttgtcagccgcagcgccaaaatcgtctcg
gcgtttattggcgacgaaattcctcaggctgagctggaagagcgtgtccgcgcggcattt
acgttcccggcaccggtaaaatccgttgagccagacattggctgcctggaacttttccac
ggtccgacgctggcgtttaaagactttggcggccgttttatggcgcaaatgctgacgcac
atcagcggtgataaaccggtcactatcctgactgcgacgtccggtgacaccggcgcggca
gtggctcacgcgttttacggtctgaaaaacgtgcgcgtagtgatcctctatccgcagggc
aaaatcagcccgttgcaggaaaaactgttctgtacgctgggcggcaatattgaaaccgtg
gctatcgacggtgattttgatgcttgtcaggcgctggtgaaacaggcctttgacgacgaa
gagctgaaagtggcgctgggcttaaactccgccaactctatcaacatcagccgcctgctg
gcgcagatttgctattacttcgaagcggtcgcgcagctcccacaggaagcacgtaatcag
ctggtgatttccgtgccaagcggtaacttcggcgatctgaccgcaggcctgctggcgaaa
tccctcggtttaccggtgaagcgttttatcgccgccaccaacgccaatgacacggttccc
cgtttcctgaaagagggcaaatggacgccaaacgcgactaaagcgaccttgtctaacgcg
atggatgtgtcacagccgaacaactggccgcgtgtggaagagctgttccgccgcaaaatc
tggcgtctgagcgatctgggttatgccgccgttaccgacgaaaccaccaaagcgacgatg
cgcgagctgaaagcggtggggtacatctctgagccgcatgcggcgattgcgtaccgcgcg
ctgcgtgaccagctcaatccaggtgagtacggattgttccttggcactgcgcatccggcg
aaatttaaagagagcgtggatgagattctgggcgagtcgctgccgctgccaaaagagctg
gcggatcgcgccgatctgccgctgctgtctcattctctgcctgcggaatttgccgcgctg
cgtaagctgatgatgacccgcgggtag

DBGET integrated database retrieval system