KEGG   Enterobacter sp. 638: Ent638_0566Help
Entry
Ent638_0566       CDS       T00507                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ent  Enterobacter sp. 638
Pathway
ent00260  Glycine, serine and threonine metabolism
ent00750  Vitamin B6 metabolism
ent01100  Metabolic pathways
ent01110  Biosynthesis of secondary metabolites
ent01120  Microbial metabolism in diverse environments
ent01230  Biosynthesis of amino acids
Module
ent_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ent638_0566
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ent638_0566
Enzymes [BR:ent01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ent638_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ABP59253
UniProt: A4W6C3
Position
636325..637611
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKQDFVSRSAKIVS
AFIGDEIPQAELEERVRAAFTFPAPVKSVEPDIGCLELFHGPTLAFKDFGGRFMAQMLTH
ISGDKPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPQGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLKEGKWTPNATKATLSNA
MDVSQPNNWPRVEELFRRKIWRLSDLGYAAVTDETTKATMRELKAVGYISEPHAAIAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVDEILGESLPLPKELADRADLPLLSHSLPAEFAAL
RKLMMTRG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacaatctgaaagatcataacgagcaggtcagcttcgcgcaggcggtgact
cagggcctgggcaaaaatcaggggttgttctttccgcacgacttgccggaatttagcctg
accgaaatcgatgaaatgctgaagcaggattttgtcagccgcagcgccaaaatcgtctcg
gcgtttattggcgacgaaattcctcaggctgagctggaagagcgtgtccgcgcggcattt
acgttcccggcaccggtaaaatccgttgagccagacattggctgcctggaacttttccac
ggtccgacgctggcgtttaaagactttggcggccgttttatggcgcaaatgctgacgcac
atcagcggtgataaaccggtcactatcctgactgcgacgtccggtgacaccggcgcggca
gtggctcacgcgttttacggtctgaaaaacgtgcgcgtagtgatcctctatccgcagggc
aaaatcagcccgttgcaggaaaaactgttctgtacgctgggcggcaatattgaaaccgtg
gctatcgacggtgattttgatgcttgtcaggcgctggtgaaacaggcctttgacgacgaa
gagctgaaagtggcgctgggcttaaactccgccaactctatcaacatcagccgcctgctg
gcgcagatttgctattacttcgaagcggtcgcgcagctcccacaggaagcacgtaatcag
ctggtgatttccgtgccaagcggtaacttcggcgatctgaccgcaggcctgctggcgaaa
tccctcggtttaccggtgaagcgttttatcgccgccaccaacgccaatgacacggttccc
cgtttcctgaaagagggcaaatggacgccaaacgcgactaaagcgaccttgtctaacgcg
atggatgtgtcacagccgaacaactggccgcgtgtggaagagctgttccgccgcaaaatc
tggcgtctgagcgatctgggttatgccgccgttaccgacgaaaccaccaaagcgacgatg
cgcgagctgaaagcggtggggtacatctctgagccgcatgcggcgattgcgtaccgcgcg
ctgcgtgaccagctcaatccaggtgagtacggattgttccttggcactgcgcatccggcg
aaatttaaagagagcgtggatgagattctgggcgagtcgctgccgctgccaaaagagctg
gcggatcgcgccgatctgccgctgctgtctcattctctgcctgcggaatttgccgcgctg
cgtaagctgatgatgacccgcgggtag

DBGET integrated database retrieval system