KEGG   Enterobacter sp. 638: Ent638_0795Help
Entry
Ent638_0795       CDS       T00507                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ent  Enterobacter sp. 638
Brite
Enzymes [BR:ent01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Ent638_0795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
891848..892384
Genome map
AA seq 178 aa AA seqDB search
MAQLKLSKKSGAAGIVCSVATIIAIVINAGHVRTNERGLELIGNAESCRRDPYVCPAGVL
TDGMGNTHGVKPGTIKSVQQIAMEWEKNILDAESCVNRYANGKMLSDDTFSAAVSVTFRA
GCGNMRKSTMFSFFREGPAAYKSACNQFSRWVYGGGRVLPGLVTRAGKEEALCLDGLK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
gtggcccagttgaaactgagtaaaaaaagtggagctgccggtattgtctgttcggtagcg
acgattatcgcgatagtaattaacgctggtcatgttcgcacaaatgagcgaggtctggag
ctcatcggaaatgccgagtcctgccgacgtgatccctatgtctgcccggcgggcgtgctg
accgatggaatgggtaacacgcacggcgtcaagcctggcactatcaagagcgttcagcag
atcgcgatggagtgggaaaagaatattctcgatgctgaatcctgcgtaaaccggtacgcc
aatggaaaaatgctgtcagatgatactttcagtgctgcggtatcggtaacctttcgcgcc
gggtgcgggaatatgcgcaaatcaaccatgtttagcttcttccgtgaggggccggctgcg
tataagtcagcctgtaatcagttctctcgctgggtatatggcggcggacgcgttctgcca
ggtctggtaactcgcgcaggtaaagaagaggctctctgtctggatggtctgaaatga

DBGET integrated database retrieval system