KEGG   Enterobacter sp. 638: Ent638_0843Help
Entry
Ent638_0843       CDS       T00507                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ent  Enterobacter sp. 638
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ent00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(941764..942738)
Genome map
AA seq 324 aa AA seqDB search
MTDLIARPRRLRQSPALRAMFEETTLTLNDLVLPIFVEEEIDDYKAIEAMPGVMRIPEKH
LAREIERIANAGIRSVMTFGISHHTDATGSDAMKENGLVARMSRICKETVPEMIVMSDTC
FCEYTSHGHCGVLCDHGVDNDATLLNLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFTDTAIMSYSTKFASSFYGPFREAAGTSLKGDRKTYQMNPLNRREAIRESLLDEAQG
ADCLMVKPAGAYLDILRDIRERTTLPLGAYQVSGEYAMIKFAAQAGAIDEEKVVLESLGA
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttaattgcacgtccccgtcgcctacgccaatcccctgcgttgcgcgctatg
tttgaagagacaacactgaccttaaacgatctggtgttgccgatttttgtcgaagaagag
atcgatgactacaaagccatcgaggcgatgccaggcgtgatgcgcatccccgaaaagcat
ctggcgcgtgaaatcgaacgcattgccaacgcggggatccgctcggtgatgactttcggc
atctcgcaccacaccgacgccaccggcagcgatgcgatgaaagaaaatggtctggtcgcg
cgcatgtcccgtatctgcaaagagacggtgccggaaatgatcgtcatgtccgatacctgc
ttctgcgaatacacctcacacggtcactgcggtgtcttatgcgatcacggcgtcgataac
gatgcaaccttgctgaacctgggcaaacaggcggtcgtggctgccgctgccggggcggat
tttattgcgccttccgccgcaatggatggtcaggtgcaggcaatccgtcaggcgctggac
gcagcgggtttcaccgataccgccatcatgtcctactccaccaaattcgcctcctccttc
tacggcccgttccgtgaagccgcaggcacgtcgctgaagggcgatcgtaaaacctatcag
atgaacccgctcaaccgccgcgaagcgatccgcgaatccctgctcgacgaagcgcaaggc
gcagattgcctgatggtcaaaccggcgggcgcttatctggatattctgcgtgatatccgc
gagcgcaccactctgccgctgggtgcctaccaggtaagcggtgaatacgcgatgatcaaa
ttcgccgcgcaagccggggcgattgacgaagagaaagtcgttctggaaagtcttggcgcg
attaaacgcgcaggcgcggatctgatcttcagctacttcgcactcgatctggctgagaaa
aaaatcctgcgttaa

DBGET integrated database retrieval system