KEGG   Enterobacter sp. 638: Ent638_0843Help
Entry
Ent638_0843       CDS       T00507                                 

Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ent  Enterobacter sp. 638
Pathway
ent00860  Porphyrin and chlorophyll metabolism
ent01100  Metabolic pathways
ent01110  Biosynthesis of secondary metabolites
ent01120  Microbial metabolism in diverse environments
Module
ent_M00121  Heme biosynthesis, glutamate => heme
ent_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ent638_0843
Enzymes [BR:ent01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Ent638_0843
Exosome [BR:ent04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ent638_0843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD ComA
Motif
Other DBs
NCBI-ProteinID: ABP59527
UniProt: A4W747
Position
complement(941764..942738)
Genome map
AA seq 324 aa AA seqDB search
MTDLIARPRRLRQSPALRAMFEETTLTLNDLVLPIFVEEEIDDYKAIEAMPGVMRIPEKH
LAREIERIANAGIRSVMTFGISHHTDATGSDAMKENGLVARMSRICKETVPEMIVMSDTC
FCEYTSHGHCGVLCDHGVDNDATLLNLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFTDTAIMSYSTKFASSFYGPFREAAGTSLKGDRKTYQMNPLNRREAIRESLLDEAQG
ADCLMVKPAGAYLDILRDIRERTTLPLGAYQVSGEYAMIKFAAQAGAIDEEKVVLESLGA
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttaattgcacgtccccgtcgcctacgccaatcccctgcgttgcgcgctatg
tttgaagagacaacactgaccttaaacgatctggtgttgccgatttttgtcgaagaagag
atcgatgactacaaagccatcgaggcgatgccaggcgtgatgcgcatccccgaaaagcat
ctggcgcgtgaaatcgaacgcattgccaacgcggggatccgctcggtgatgactttcggc
atctcgcaccacaccgacgccaccggcagcgatgcgatgaaagaaaatggtctggtcgcg
cgcatgtcccgtatctgcaaagagacggtgccggaaatgatcgtcatgtccgatacctgc
ttctgcgaatacacctcacacggtcactgcggtgtcttatgcgatcacggcgtcgataac
gatgcaaccttgctgaacctgggcaaacaggcggtcgtggctgccgctgccggggcggat
tttattgcgccttccgccgcaatggatggtcaggtgcaggcaatccgtcaggcgctggac
gcagcgggtttcaccgataccgccatcatgtcctactccaccaaattcgcctcctccttc
tacggcccgttccgtgaagccgcaggcacgtcgctgaagggcgatcgtaaaacctatcag
atgaacccgctcaaccgccgcgaagcgatccgcgaatccctgctcgacgaagcgcaaggc
gcagattgcctgatggtcaaaccggcgggcgcttatctggatattctgcgtgatatccgc
gagcgcaccactctgccgctgggtgcctaccaggtaagcggtgaatacgcgatgatcaaa
ttcgccgcgcaagccggggcgattgacgaagagaaagtcgttctggaaagtcttggcgcg
attaaacgcgcaggcgcggatctgatcttcagctacttcgcactcgatctggctgagaaa
aaaatcctgcgttaa

DBGET integrated database retrieval system