KEGG   Enterobacter sp. 638: Ent638_0968Help
Entry
Ent638_0968       CDS       T00507                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1 (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ent  Enterobacter sp. 638
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Ent638_0968
Enzymes [BR:ent01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Ent638_0968
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Ent638_0968
Lipid biosynthesis proteins [BR:ent01004]
 Fatty acid synthase
  Component type
   Ent638_0968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1077160..1077786)
Genome map
AA seq 208 aa AA seqDB search
MMNCNNVFRWHLPFLFLILMTFRAAAADTLLVLGDSLSAGYRMAATAAWPALLNDKWQTK
TPVLNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRKIIQD
IQAANAQPLLMQIRLPANYGRRYNESFSAIYPKLAKEFDIPLLPFFMEEVYLKPQWMQDD
GIHPNRDAQPFIADWMATRLAPLVKHDS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatgaactgcaacaatgttttccgctggcatttgcccttcctgtttctgattctgatg
acgtttcgcgccgcggcggcggacacgttactggtgctgggtgacagcctgagcgcgggc
tatcgaatggcggccacagccgcatggcccgcgctgctcaacgataaatggcaaactaaa
acgccagtgctgaatgccagcatcagcggcgatacttcgcagcaggggcttgcgcgtcta
cctgccctgctcaaacaacatcaaccacgctgggtgttagtggaactgggcggtaacgac
ggtttacgcggattccaaccgcagcaaactgaacaaacgctgcgcaaaatcattcaagat
attcaggccgccaatgcgcaaccgctattaatgcaaattcgtctgcccgctaactacggt
cgccgttataatgagtcctttagcgccatctatcccaagcttgccaaagaattcgatatt
ccgctgctgccatttttcatggaagaggtctatctgaagccgcaatggatgcaggatgac
ggtatacaccccaatcgcgacgcccagccgtttatcgccgactggatggcaacacggctg
gccccactagttaaacatgactcttaa

DBGET integrated database retrieval system