KEGG   Enterobacter sp. 638: Ent638_1227Help
Entry
Ent638_1227       CDS       T00507                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ent  Enterobacter sp. 638
Pathway
ent00020  Citrate cycle (TCA cycle)
ent00310  Lysine degradation
ent01100  Metabolic pathways
ent01110  Biosynthesis of secondary metabolites
ent01120  Microbial metabolism in diverse environments
ent01130  Biosynthesis of antibiotics
ent01200  Carbon metabolism
Module
ent_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ent_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ent638_1227
  Amino acid metabolism
   00310 Lysine degradation
    Ent638_1227
Enzymes [BR:ent01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Ent638_1227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: ABP59908
UniProt: A4W878
Position
1352882..1354117
Genome map
AA seq 411 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSVKRDEVLVEIETDKVVLEVPASADGILDAV
LEDEGTTVTSRQILGRLREGNSGGKESSAKSESKESTPAQRQQASLSEQSNDALSPAIRR
LLSEHNLEASAIKGTGVGGRLTREDVEKHLAKAPAKEEAEAPAAASAPATATAQPALGAR
SEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDAFEKRHGIRLGF
MSFYVKAVVEALKRYPEVNASIDGEDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMAD
IEKRIKELALKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDR
PMAVDGKVEILPMMYLALSYDHRLIDGRESVGYLVAIKELLEDPTRLLLDV
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgttcccgacctgcctgaatccgtggctgacgcaacggta
gcgacctggcataaaaaaccgggcgatagcgttaagcgcgatgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcatcggcggatggcattctggatgcagtg
ctggaagatgaaggcacgaccgtgacctctcgccagattctgggtcgcctgcgtgaaggc
aatagcggtggtaaagagtccagcgccaagtctgaaagcaaagagtccacgccggctcag
cgtcagcaagcctctctatccgagcagagcaacgatgcacttagcccagcgatccgtcgc
ctgctgagtgaacataacctcgaagccagcgctatcaaaggcactggcgtgggtggccgt
ctgacgcgtgaagatgttgaaaaacatctggcgaaagcaccagccaaagaagaagccgaa
gcgccggcagccgcgtctgctccagctaccgctaccgcacagcctgctctgggtgcacgt
agcgaaaaacgtgtgccgatgacgcgcctgcgtaagcgtgtggctgagcgtctgctggaa
gcgaaaaactccaccgcgatgctgacgaccttcaacgaagtcaacatgaagccgatcatg
gatctgcgtaagcagtacggtgatgcgtttgaaaaacgccacggtatccgtttgggcttt
atgtctttctatgtgaaagcggttgttgaagcgctgaaacgctatccggaagtcaacgcg
tctatcgatggcgaagacgtggtgtatcacaactatttcgatgtgagcatggccgtttct
acaccgcgtggcctggtgaccccagttctgcgtgatgtggataccctgggcatggctgac
atcgagaaacgcatcaaagagctggccctgaaaggccgtgacggcaaactgaccgtggaa
gacctgactggcggtaacttcaccattaccaacggcggtgtgtttggttcgttaatgtct
acgccaattatcaacccgccgcagagcgcgatcctgggcatgcatgccattaaagatcgt
ccaatggcggtcgacggtaaagtagagatcctgccaatgatgtacctagcactctcttac
gatcaccgtctgattgatggccgtgagtcggttggttatctggtggcgattaaagagctg
ctggaagatccaacgcgtcttctgctggacgtgtag

DBGET integrated database retrieval system