KEGG   Enterobacter sp. 638: Ent638_1246Help
Entry
Ent638_1246       CDS       T00507                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ent  Enterobacter sp. 638
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ent638_1246
   01230 Biosynthesis of amino acids
    Ent638_1246
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ent638_1246
  Energy metabolism
   00680 Methane metabolism
    Ent638_1246
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ent638_1246
Enzymes [BR:ent01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Ent638_1246
Exosome [BR:ent04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Ent638_1246
  Exosomal proteins of melanoma cells
   Ent638_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1371667..1372419)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVGEAKAAGKLLKDEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLTDAELPQTESLALTIDRVVPYWNDTILPRVKSGERVI
VAAHGNSLRALVKYLDNLGEEEILELNIPTGVPLVYEFDENFKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtgcgccacggcgaaagtcagtggaacaacgaaaac
cgcttcaccggttggtatgatgttgatctgtctgagaaaggcgtgggcgaagcaaaagct
gcaggtaaactgctgaaagatgaaggctttagctttgattttgcttacacctcagtgctg
aaacgtgccatccatactctgtggaacgtgctggatgaactggatcaagcctggctgcca
gttgagaaatcctggaagctgaatgagcgtcactacggtgcgctgcagggtctgaacaaa
gctgaaaccgctgaaaaatacggtgacgagcaggttaagcagtggcgtcgcggctttgcg
gtgactccaccagagctgaccaaagacgacgagcgctatccgggccacgatccgcgttac
gctaaactgaccgatgccgagctgccacagaccgagagcctggcgctgaccatcgatcgc
gttgtgccttactggaacgacacgattctgccacgcgtgaaaagcggtgagcgcgtgatc
gttgccgctcacggtaactccctgcgtgcgctggtgaaatacctggacaacttgggcgaa
gaagaaattctcgaactgaacatcccgactggcgtaccgctggtgtatgagttcgatgaa
aacttcaaacctatcaaacgttactatctaggtaacgctgacgaaatcgcagcaaaagca
gcggccgtagcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system