KEGG   Enterobacter sp. 638: Ent638_1246Help
Entry
Ent638_1246       CDS       T00507                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ent  Enterobacter sp. 638
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ent638_1246
   01230 Biosynthesis of amino acids
    Ent638_1246
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ent638_1246
  Energy metabolism
   00680 Methane metabolism
    Ent638_1246
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ent638_1246
Enzymes [BR:ent01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Ent638_1246
Exosome [BR:ent04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Ent638_1246
  Exosomal proteins of melanoma cells
   Ent638_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1371667..1372419)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVGEAKAAGKLLKDEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLTDAELPQTESLALTIDRVVPYWNDTILPRVKSGERVI
VAAHGNSLRALVKYLDNLGEEEILELNIPTGVPLVYEFDENFKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtgcgccacggcgaaagtcagtggaacaacgaaaac
cgcttcaccggttggtatgatgttgatctgtctgagaaaggcgtgggcgaagcaaaagct
gcaggtaaactgctgaaagatgaaggctttagctttgattttgcttacacctcagtgctg
aaacgtgccatccatactctgtggaacgtgctggatgaactggatcaagcctggctgcca
gttgagaaatcctggaagctgaatgagcgtcactacggtgcgctgcagggtctgaacaaa
gctgaaaccgctgaaaaatacggtgacgagcaggttaagcagtggcgtcgcggctttgcg
gtgactccaccagagctgaccaaagacgacgagcgctatccgggccacgatccgcgttac
gctaaactgaccgatgccgagctgccacagaccgagagcctggcgctgaccatcgatcgc
gttgtgccttactggaacgacacgattctgccacgcgtgaaaagcggtgagcgcgtgatc
gttgccgctcacggtaactccctgcgtgcgctggtgaaatacctggacaacttgggcgaa
gaagaaattctcgaactgaacatcccgactggcgtaccgctggtgtatgagttcgatgaa
aacttcaaacctatcaaacgttactatctaggtaacgctgacgaaatcgcagcaaaagca
gcggccgtagcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system