KEGG   Enterobacter sp. 638: Ent638_1247Help
Entry
Ent638_1247       CDS       T00507                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ent  Enterobacter sp. 638
Pathway
ent00010  Glycolysis / Gluconeogenesis
ent00052  Galactose metabolism
ent01100  Metabolic pathways
ent01110  Biosynthesis of secondary metabolites
ent01120  Microbial metabolism in diverse environments
ent01130  Biosynthesis of antibiotics
Module
ent_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ent638_1247
   00052 Galactose metabolism
    Ent638_1247
Enzymes [BR:ent01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Ent638_1247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABP59928
UniProt: A4W898
Position
complement(1372743..1373783)
Genome map
AA seq 346 aa AA seqDB search
MLNETPTLAADGLPYRLLTLRNSAGMVVTVMDWGATLLSARVPMPDGSVRETLLGCASPE
QYLNQAAYLGASVGRYANRIAKSRFTLDGTDYALLPSQGENQLHGGPEGFDKRRWRIVQQ
NDCEVLFALESADGDQGFPGHLSASAKFTLTEDNRISIEYRATVDKPCPVNMTNHAYFNL
DGDQSDVRQHKLQLLADAWLPVDEMGIPSEGLKAVAGTSFDFRTPKTIAKEFLSDDDQRK
VKGYDHAFLLQAKGDVTQPAAQVWSADEKLQMTVFTNAPALQFYSGNYLGGTPAREQGDY
SDWQGLALESEFLPDSPNHPEYPQPDCILRPGSEYVSLTEYQFITH
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaacgaaacacctacgcttgccgccgatggcctgccgtaccgcctgttaaccctg
cgcaacagcgcggggatggtggtcacggtcatggattggggcgcaactttactttctgct
cgcgttccgatgcctgacggcagcgtgcgcgaaacgttgctcggctgcgcgtcgccggag
cagtatttgaatcaggccgcgtatctcggtgcatccgtgggccgttacgcgaaccgcatc
gcgaaaagccgttttacgctcgatgggacagattacgcgcttttaccaagccaaggtgaa
aaccagcttcacggtgggcctgaagggttcgacaaacgccgctggcgtatcgtgcagcag
aatgattgtgaggtcctgtttgcgctggaatctgctgatggcgatcagggcttccccggc
cacctgtccgcgtcagcgaaatttacgctgacagaagataaccgcatctcaattgagtac
cgtgcgacagtcgataagccatgcccggtgaacatgaccaatcatgcgtatttcaatctg
gatggcgaccagtccgacgtccgtcagcataagctccagctgctggccgatgcctggttg
ccggtcgatgaaatgggtattccttctgaagggctaaaagccgttgccggtacgagcttt
gacttccgcacacctaaaaccatcgcgaaagagttcctgagcgatgatgaccagcgcaag
gtgaaaggctacgatcacgcgttcttgctgcaggcgaaaggggatgtcacccagcccgcc
gcgcaggtgtggtctgcagatgaaaaactgcaaatgacggtgttcaccaatgcccctgcg
ttgcagttctattcgggtaactacctcggcggaacgccagcgcgcgagcaaggtgattac
agtgactggcagggtctggcgctggaaagtgagtttttgcctgatagcccgaatcatcca
gaatacccgcagccggactgcattctgcgaccgggttcggagtacgtcagcctgacggaa
tatcagtttataacgcattaa

DBGET integrated database retrieval system