KEGG   Enterobacter sp. 638: Ent638_1622Help
Entry
Ent638_1622       CDS       T00507                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ent  Enterobacter sp. 638
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ent638_1622
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Ent638_1622
Enzymes [BR:ent01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Ent638_1622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1773463..1774476
Genome map
AA seq 337 aa AA seqDB search
MLDVEGYELDAEEREILAHPLVGGLILFTRNYHDPEQLRELVRQIRAASRNHLVVAVDQE
GGRVQRFRDGFTRLPAAQSFAALMGTEEGGNLAQDAGWLMASEMIAMDIDISFAPVLDVG
HISAAIGERSYHEDPNIALAMATRFIDGMHDAGMKTTGKHFPGHGAVTADSHKETPRDPR
PEAEIRAKDMSVFRSLITDNKLDAIMPAHVIYSDVDPRPASGSSHWLQTVLRKELGFNGV
IFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPINAERVTQLY
HKGSFSRQELMSSARWKAVNAQLEALNERWQAHKAGQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgtcgaagggtatgaactggatgcggaagaacgcgagattctggcgcatccg
ctggtgggtggcttgattctgtttacccgcaactatcacgatccagaacagttgcgcgag
ctggtccgccaaatccgcgcggcatcgcgcaatcaccttgtggtggcagtagatcaggaa
ggcggtcgcgtgcagcgttttcgtgacggatttacccgtttacctgccgcgcaatcattc
gctgcgttgatgggaacagaagagggcggtaatctggcacaagacgcgggctggttaatg
gcgagcgaaatgatcgccatggacatcgacatcagctttgcgccggtgctggatgtgggt
catatcagcgccgcgattggcgagcgttcatatcatgaagatccgaatatcgctctggcg
atggcgacgcgctttattgacggcatgcatgatgccgggatgaaaacgaccgggaagcat
ttcccggggcacggtgcggtcaccgcagattcgcacaaagagaccccgcgcgatccgcgt
ccggaagcggagattcgcgccaaagatatgtcggtgttccgatccctgattaccgataac
aaactcgatgccatcatgccagcgcatgtgatttacagtgatgtcgatccgcgcccggcc
agcggttcatcgcactggctgcaaacggtgctgcgcaaagagctgggttttaacggcgtg
atcttctctgacgatttgtcgatggaaggggcggcgatcatgggtagctacgcggagcgc
ggacaagcgtcgctggatgcaggttgcgatatgatcctcgtctgcaataatcgtaaaggt
gcggtgagcgtgttagataacctgtcgccgatcaatgctgaacgtgttacacaattgtat
cataaaggttcatttagccgtcaggagctgatgagcagcgctcgctggaaagcggtgaac
gcgcagctcgaagcactcaatgagcgctggcaggcacacaaagcgggccaataa

DBGET integrated database retrieval system