KEGG   Enterobacter sp. 638: Ent638_1685Help
Entry
Ent638_1685       CDS       T00507                                 

Definition
glutamate dehydrogenase (EC:1.4.1.4)
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
ent  Enterobacter sp. 638
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:ent00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ent00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ent00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1836007..1837350)
Genome map
AA seq 447 aa AA seqDB search
MDQTRTLESFLTHVQSRDPHQSEFAQAVREVMTTLWPFLEENPRYRQMSLLERLVEPERV
IQFRVVWVDDRNQVQVNRAWRVQFNSAIGPFKGGMRFHPSVNLSILKFLGFEQTFKNALT
TLPMGGGKGGSDFDPKGKSEGEVMRFCQALMTELYRHLGPDTDVPAGDIGVGGREVGFMA
GMMKKLSNNSACVFTGKGLSFGGSLIRPEATGYGLVYFTEAMLKRHGLGFEGMRVAVSGS
GNVAQYAIEKAMQFGARVITASDSSGTVVDEAGFTTEKLARLCEIKASRDGRVADYAREF
GLTYLEGKQPWSVPVDIALPCATQNELDVDAAQQLIANGVKAVAEGANMPTTIEATDLFL
QAGVLFAPGKAANAGGVATSGLEMAQNAARMGWKAEKVDARLHHIMLDIHHACVEYGGED
KQTNYVRGANIAGFVKVADAMIGQGVI
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggatcagacacgcactctggaatcgtttcttacccatgttcaaagccgcgacccgcat
cagagcgagttcgcgcaggccgttcgcgaagtcatgaccacgttgtggccgtttcttgaa
gaaaacccgcgttatcgtcagatgtcgttgcttgagcgtctggttgagccggagcgtgtc
attcagttccgcgtggtgtgggttgacgatcgtaatcaggtgcaggttaaccgcgcatgg
cgcgtccagtttaactccgctatcggcccgtttaagggcgggatgcgtttccacccttcc
gtgaatttatcgattctgaagttcctgggctttgaacagacattcaaaaatgcgctcacc
accctgccgatgggcggcgggaaaggcggcagcgattttgatccgaaaggcaaaagcgaa
ggcgaagtgatgcgtttctgccaggcgctgatgaccgaactgtatcgccatcttgggcct
gataccgacgtgcctgcgggcgatatcggcgttggcgggcgtgaagttggctttatggcc
gggatgatgaagaagctgtctaacaacagcgcctgcgtgttcactggcaaaggactctct
ttcggcgggagtttgatccgtccagaagcgacaggctatggtctggtctatttcaccgag
gcgatgttaaaacgccacggtttgggctttgaaggcatgcgcgtagcggtttccgggtcc
ggaaacgtggcgcagtacgcgattgaaaaagcgatgcagtttggcgcacgcgtgattacc
gcctctgactccagcggtacggtggtggatgaagccggtttcaccacggagaaactggcg
cgtctgtgtgaaatcaaagccagccgtgacggccgcgtggccgattatgcgcgtgagttt
ggcctgacctatctggaaggcaaacagccgtggtcggtgccggtggatatcgccctgccg
tgtgcaacgcaaaatgagctggacgtcgacgcggcgcagcaactgatcgcgaatggcgtg
aaagctgtggctgaaggcgcgaacatgccgacgaccatcgaagcgaccgacctgttcctg
caagcgggcgtgctgtttgcgccaggcaaagcggcgaacgcgggcggcgtggcgacttca
ggtctggaaatggcgcagaacgcggcgcgtatgggctggaaagccgagaaagtggatgcg
cgcctgcatcacatcatgctggatattcaccacgcctgcgtcgagtatggcggtgaagat
aagcagaccaactatgtgcgcggcgcgaatatcgctggcttcgtgaaagtcgccgatgcg
atgattgggcaaggtgtgatttaa

DBGET integrated database retrieval system