KEGG   Enterobacter sp. 638: Ent638_1732Help
Entry
Ent638_1732       CDS       T00507                                 

Gene name
btuE
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ent  Enterobacter sp. 638
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Ent638_1732 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Ent638_1732 (btuE)
Enzymes [BR:ent01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Ent638_1732 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1881912..1882463
Genome map
AA seq 183 aa AA seqDB search
MQHDILNTEVTTIDGETTTLEGYKGKVLLIVNVASKCGLTPQYEQLENIQKAWEKDGLVV
LGFPCNQFLGQEPGSEEEIKTFCSTTYGITFPMFSKIDVNGENRHPLYQKLIAAAPTAVT
PEQSGFYERMASKGRAPLYPDDILWNFEKFLIGRDGQVVQRFSPDMTPEDPIVMESIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacgacattctgaacaccgaagttacaaccattgatggcgaaacaacaacgctg
gaaggctacaaaggtaaagtgttgttaatcgtgaacgttgcgtcgaaatgcggtttgacg
ccgcagtatgaacagttggaaaacatccaaaaagcctgggagaaggatgggctggtggtt
ctcggtttcccgtgcaatcagttcctgggtcaggagccgggtagcgaagaggagatcaaa
acgttttgcagcaccacctatggcatcacgttcccgatgttcagcaaaattgatgtgaac
ggtgaaaatcgccatcccctctatcaaaagctgatcgccgccgctccaacagccgtcacg
ccagaacaaagcggattctacgaacgtatggcgagcaaaggacgtgcccccctgtatccg
gatgatattttgtggaacttcgaaaaattcctgattggccgtgatggacaggttgtacaa
cgcttttccccggatatgacgccagaagatcctattgtgatggaatctatcaagctggca
ctggccaagtaa

DBGET integrated database retrieval system