KEGG   Enterobacter sp. 638: Ent638_2007Help
Entry
Ent638_2007       CDS       T00507                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ent  Enterobacter sp. 638
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ent00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ent00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:ent00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2180107..2181033
Genome map
AA seq 308 aa AA seqDB search
MAAVIDNEMLDDILAQVRPLLGQGKVADYIPALASVSGNKLAIAICTVEGQLYQAGDATE
RFSIQSISKVLSLVAAMRQYEEDEIWQRVGKDPSGQPFNSLLQLEIEQGKPRNPFINAGA
LVVCDMLQSRLSAPRQRMLEIVRQLSGVSDLSYDANVARSEFEHSARNAAIAWLMKSFGN
FHNDVATVLQNYFHYCALKMSCVELARTFLFLADKGYSSHHAQAVVTPMQARQVNALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGVVAIVPHEMAIAVWSPELDDTGNSLAGVAVLEKLT
QRLGRSVY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggctgcggtcattgataatgagatgctggacgatattctggcgcaagttcgcccgtta
ctggggcagggaaaggtcgccgattacattcccgcgctcgcctcggtgagcggaaacaaa
ctggcgattgccatttgtaccgtggagggacagctttatcaggccggcgatgccaccgag
cgcttctctattcagtccatctccaaagtattaagcctggtcgcggcgatgcgtcagtac
gaggaagacgagatttggcaacgggtcggtaaagatccctctggtcagccgtttaactcg
ctgctgcagctggaaatcgaacaggggaaaccccgtaatccgtttattaacgccggggcg
ctggtggtgtgcgatatgctgcaaagccgccttagcgcgccgcgtcagcgcatgctggaa
attgtgcgccagctgagcggcgtatctgacctgagctacgacgccaatgttgcacgctct
gaatttgaacattcagcgcgaaatgctgcgattgcctggctgatgaaatccttcggcaat
tttcataacgatgtcgctacggtgctgcagaactatttccactattgcgcgttgaagatg
agctgcgtagagctggcgcgtacgtttctgtttctggccgataagggctattcctcgcac
cacgcgcaggcggtggtgacgcctatgcaggcgcgtcaggtgaatgcgcttatggcgacc
agcgggatgtatcagaatgccggtgaatttgcgtggcgcgtagggctgcctgcaaaatcg
ggcgtcggcggcggcgtggtcgcgattgtgccgcatgagatggcgattgccgtgtggagc
ccggaactggatgacaccggtaattcccttgcgggcgtcgcggtacttgaaaagctgacc
cagcgtcttggtcgatccgtttactga

DBGET integrated database retrieval system