KEGG   Enterobacter sp. 638: Ent638_2022Help
Entry
Ent638_2022       CDS       T00507                                 

Definition
(GenBank) beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ent  Enterobacter sp. 638
Pathway
ent00052  Galactose metabolism
ent00500  Starch and sucrose metabolism
ent01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Ent638_2022
   00500 Starch and sucrose metabolism
    Ent638_2022
Enzymes [BR:ent01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Ent638_2022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: ABP60698
UniProt: A4WAG8
Position
2195080..2196489
Genome map
AA seq 469 aa AA seqDB search
MTIPSRWPAVLQAVMKGQPQTLTDDHYPQWHLAPVIGLMNDPNGFIWFAGRYHLFYQWNP
LGCDHRYKCWGHWSSADLVQWQHEPMALMPDEEYDRNGCYSGSAVDNQGVLTLCYTGNVK
FDDGSRTAWQCLAVQNEAGGFDKLGPVLPLPEGYTGHVRDPKVWQHDGQWYMVLGAQDLQ
KRGKVLLYQSADLHSWQPLGEIAGHGVNDLADAGYMWECPDLFELDGTHVLICCPQGLAR
EPHRYRNTYPSTWMSGDFHYDDAKFEHGALHELDAGFEFYAPQTTLAADGRRILIGWMGV
PDGEEVLQPTCEHGWIHQMTCPRELHFRDGKLLQTPIRELQQLREEEQNWHGNAASAPAL
DAGRLEFELKTDAAVKVNFADTLWLSLDEKGIRLERKSLRNDEILTRYWNGKVTSLRVLC
DRSSVEIFINEGEGVMSSRYFPGHPAQIRFEGASVITLRYWLLRASMIE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacgattccttctcgctggcctgcggtactgcaggccgtcatgaaaggccaaccgcag
acgttaactgacgatcattatcctcagtggcatcttgcgccggtgatcggattgatgaac
gatcccaacggttttatctggtttgccggacgttaccatctgttctatcagtggaacccg
ctgggctgcgatcatcgttataaatgctggggccactggagttcggctgatttagtgcag
tggcagcatgaaccgatggcgctgatgccggatgaagaatacgaccgtaacggctgctac
tccggtagcgccgtggataatcagggcgttttaacgctgtgctataccggcaacgtcaaa
tttgatgacggcagtcgcaccgcatggcaatgcctggcagtacaaaatgaagccggtggt
ttcgataagctcggtccagtattgccactaccggaaggttataccggccatgtgcgcgac
ccaaaagtgtggcagcacgatgggcagtggtacatggtgctgggcgcacaggatttacaa
aagcgcggcaaagtgctgctgtatcagtctgcggatttgcacagctggcagcccctcggc
gaaatcgcgggccacggcgtgaacgatctggccgatgcagggtatatgtgggagtgtccg
gacctgttcgagctggacggtacgcacgtgttgatctgctgcccgcagggactggcgcgc
gaaccgcatcgctatcgcaatacctatccctctacctggatgagcggcgattttcactat
gacgatgcgaaatttgaacatggcgcactgcacgaactggatgccgggtttgaattttat
gccccgcaaacgacattagcggcagatggccgtcggatcctgattggctggatgggcgtc
ccggacggggaagaagtactacaaccaacctgcgaacacggctggatccatcagatgacg
tgtccgcgcgagctgcatttccgcgacggaaaacttttgcaaacaccgattcgggaactg
caacagctgcgcgaggaagagcaaaactggcacggaaatgcagcgtcagcccccgcgctg
gacgccgggcgtcttgagttcgagctcaaaacagacgcggcggtgaaggtgaacttcgcc
gatacgctgtggctcagcctggacgaaaaggggattaggcttgaacgaaaaagcctgcgc
aacgatgaaatattgacgcgttactggaacggaaaggtcacttctctacgcgttttgtgc
gacagatccagtgtcgaaattttcattaatgaaggcgagggcgtgatgagcagccgctat
ttcccgggccatccggcgcaaatacgcttcgaaggtgcgtccgtcatcacattacgctac
tggttgcttcgcgctagcatgatagaatga

DBGET integrated database retrieval system