KEGG   Enterobacter sp. 638: Ent638_2165Help
Entry
Ent638_2165       CDS       T00507                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ent  Enterobacter sp. 638
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ent638_2165
Enzymes [BR:ent01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Ent638_2165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2355531..2357228)
Genome map
AA seq 565 aa AA seqDB search
MENSMDDKIEQLIRLIYGESFSLGHYEILSENIKNAKNLITGTRKSKWDEQDVVLITYAD
QFQKNDQNALPILTRFYNRWLSPYFSHVHLLPFYPWSSDDGFSVMDYHRVAAKTGEWGDV
AELKKSTHLMFDFVCNHMSAKSQWFENYLNQNPGFEDFFIAVDPDTDLSAVTRPRALPLL
TPFTLADGSIRHLWTTFSEDQIDLNFASPQVLIAMVDVLLHYLIEGADYIRLDAVGFMWK
VPGTTCLHLENTHRLIQLFRAITEAVAPGTVIITETNVPHKDNISYFGDGSNEAQMVYQF
SLPPLVLHSIHSENVHALCQWAQTLELPSTETTWFNFLASHDGIGLNPLRGILPEEDILT
LVEKLQNEGARVNWKNNPDGTRSPYEINVTYLDALTSHNCHDNERIARFVLAHALLLSFP
GVPAIYIQSILGSRNDYDGVERLGYNRAINRRKFQAGEIDAELEDASQLRTKIYNALTRM
IAIRRQQCVFHPDSKANFSMPNEHVLKITRISAGGEELTAFFNFQNRVQTLYDDIPYGVE
LLTGSNITNSLLTLNPWQVMWIKHC
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattcaatggacgataaaatagagcaacttattagactcatctacggagagtca
ttttctttaggacactatgaaatcctttctgaaaatattaagaacgcaaaaaaccttatt
actggtacccgtaaatcgaagtgggatgagcaggatgtggtattaataacgtatgccgat
cagtttcaaaaaaatgaccaaaatgcattaccaatattgacgcggttctataatcgttgg
ctgtcaccttacttttcgcatgtccatctattaccgttttacccatggtcttctgacgac
ggtttttctgttatggattatcaccgagttgcggcgaaaacaggtgagtggggagatgta
gcagaactaaaaaaatcaactcatctcatgtttgattttgtctgtaatcatatgtcggca
aaaagtcagtggtttgaaaactatttgaatcaaaatccgggatttgaagacttttttatt
gctgttgatcccgatactgatttatccgccgtcacgcgtcccagagccttgccgctttta
acgccgtttacgctggcggatggttcaatccgccatttatggacgacgttcagtgaagat
cagattgatttgaactttgccagtccgcaggtcctgatcgccatggttgatgttctgctg
cactatctcattgaaggggcggattacatccggcttgatgcggtgggctttatgtggaaa
gtaccgggcacaacctgtctgcatctggaaaatacacaccggctgatccagttattccgc
gctatcactgaagcggtcgcgccgggtacggtgatcatcacggaaacgaatgtcccgcac
aaagacaacatttcctattttggtgatgggtcaaatgaagcgcaaatggtgtatcagttt
tcattgccgccactcgtgctccacagcattcacagtgaaaatgtgcacgcgctttgtcag
tgggcgcaaacgcttgagttgccttcaaccgagacgacctggtttaactttctcgcttcc
cacgacggtatagggttaaacccattacgcggtattctaccggaagaagacattctaacg
ctggtcgaaaaactgcaaaatgaaggtgcgagagtcaactggaaaaataatcctgatggc
acacgtagcccgtatgaaattaacgttacgtatttggatgcgttaacgtctcataactgt
cacgataatgaacgtatcgccagatttgtgttggcccatgcgctgttattaagttttccc
ggcgtaccggctatttatattcaaagtattttgggctcgcgcaatgattatgatggcgtt
gaacggttgggttacaatcgcgcgataaatcgtcgtaaatttcaggctggagaaattgat
gcagagttggaagatgcatctcaattacgcactaaaatttataatgcgttgaccaggatg
attgctattcgacgtcaacagtgcgtattccatccagacagtaaagctaatttctcaatg
ccaaatgaacatgtgcttaaaataacgcgaatctctgcgggtggtgaggaattaacagcc
ttttttaattttcagaatagagtgcaaactctttatgacgatataccttatggagtggaa
ctcttaacaggttccaatataaccaatagtctactgacactcaatccatggcaggtgatg
tggattaaacattgttaa

DBGET integrated database retrieval system