KEGG   Enterobacter sp. 638: Ent638_2207Help
Entry
Ent638_2207       CDS       T00507                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ent  Enterobacter sp. 638
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ent638_2207
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ent638_2207
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ent638_2207
Enzymes [BR:ent01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ent638_2207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2398881..2400074
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPAFQAEFTDLLKNYAGRPTALT
KCRNLTEGTKTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LACALLGLKCRIYMGAKDIERQSPNVFRMRLMGADVIPVHSGSATLKDACNEALRDWSGS
YDTAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILEKEGRLPDAVIACVGGGSNAIGM
FADFIDDTSVGLIGVEPAGHGIESGEHGAPLKHGRVGIYFGMKSPMMQTDEGQIEESYSI
SAGLDFPSVGPQHAHLNSIGRAEYVSITDDEALEAFKTLCRNEGIIPALESSHALAYALK
MIKEDPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattattaaatccgtatttcggcgagttcggtgggatgtacgttccgcaaatt
ctgatgcctgccctgcgccagctcgaagaagcgtttgtgagcgcccagaaagatccggcg
ttccaggccgaattcaccgacctgttgaaaaactacgcgggccgcccgacggcgctgacc
aaatgccgcaacctgaccgaaggcaccaagaccacgctgtacctcaagcgtgaagatttg
ctgcacggtggcgcgcacaaaaccaaccaggtgcttggccaggcgttgctcgccaaacgc
atgggcaaaacggaaattatcgccgagacaggtgccggacagcacggtgtagcgtcggct
ctggcctgcgccctgctcggcctgaaatgccgcatctatatgggtgccaaagacattgag
cgtcagtcacctaacgtgttccgtatgcgtttgatgggtgcagatgtgattcctgtgcac
agcggctccgcgacgctgaaagatgcctgtaacgaagcgctgcgcgactggtctggcagc
tatgataccgcgcactacatgcttggtacggcagcaggcccgcaccccttcccgaccatt
gtgcgtgaattccagcgcatgatcggcgaagaaaccaaagcgcagatcctcgaaaaagag
ggtcgtctgccggatgcggtgatcgcctgtgtgggcggcggttcaaacgccatcggcatg
ttcgctgactttattgatgacaccagcgttgggttgattggcgttgaacctgcaggtcac
ggcattgaaagcggcgagcacggcgcaccgctgaagcacggtcgcgtagggatttatttc
ggtatgaaatcgccgatgatgcagaccgatgaagggcagatcgaagaatcttattccatc
tcggcaggtctcgacttcccgtccgtcgggccacagcatgcgcatctgaacagcatcggc
cgtgcagaatatgtgtcgattaccgatgacgaagcgctggaagccttcaaaaccctgtgt
cgtaacgaagggattatcccggcgctcgaatcttctcatgcccttgcctatgcactgaaa
atgattaaagaggacccggaaaaagagcagttactggtggttaacctttccggtcgcggt
gacaaagacatcttcaccgttcacgatattttgaaagcacgaggggaaatctga

DBGET integrated database retrieval system