KEGG   Enterobacter sp. 638: Ent638_2207Help
Entry
Ent638_2207       CDS       T00507                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ent  Enterobacter sp. 638
Pathway
ent00260  Glycine, serine and threonine metabolism
ent00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ent01100  Metabolic pathways
ent01110  Biosynthesis of secondary metabolites
ent01130  Biosynthesis of antibiotics
ent01230  Biosynthesis of amino acids
Module
ent_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ent638_2207
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ent638_2207
Enzymes [BR:ent01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ent638_2207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABP60882
UniProt: A4WB02
Position
2398881..2400074
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPAFQAEFTDLLKNYAGRPTALT
KCRNLTEGTKTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LACALLGLKCRIYMGAKDIERQSPNVFRMRLMGADVIPVHSGSATLKDACNEALRDWSGS
YDTAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILEKEGRLPDAVIACVGGGSNAIGM
FADFIDDTSVGLIGVEPAGHGIESGEHGAPLKHGRVGIYFGMKSPMMQTDEGQIEESYSI
SAGLDFPSVGPQHAHLNSIGRAEYVSITDDEALEAFKTLCRNEGIIPALESSHALAYALK
MIKEDPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattattaaatccgtatttcggcgagttcggtgggatgtacgttccgcaaatt
ctgatgcctgccctgcgccagctcgaagaagcgtttgtgagcgcccagaaagatccggcg
ttccaggccgaattcaccgacctgttgaaaaactacgcgggccgcccgacggcgctgacc
aaatgccgcaacctgaccgaaggcaccaagaccacgctgtacctcaagcgtgaagatttg
ctgcacggtggcgcgcacaaaaccaaccaggtgcttggccaggcgttgctcgccaaacgc
atgggcaaaacggaaattatcgccgagacaggtgccggacagcacggtgtagcgtcggct
ctggcctgcgccctgctcggcctgaaatgccgcatctatatgggtgccaaagacattgag
cgtcagtcacctaacgtgttccgtatgcgtttgatgggtgcagatgtgattcctgtgcac
agcggctccgcgacgctgaaagatgcctgtaacgaagcgctgcgcgactggtctggcagc
tatgataccgcgcactacatgcttggtacggcagcaggcccgcaccccttcccgaccatt
gtgcgtgaattccagcgcatgatcggcgaagaaaccaaagcgcagatcctcgaaaaagag
ggtcgtctgccggatgcggtgatcgcctgtgtgggcggcggttcaaacgccatcggcatg
ttcgctgactttattgatgacaccagcgttgggttgattggcgttgaacctgcaggtcac
ggcattgaaagcggcgagcacggcgcaccgctgaagcacggtcgcgtagggatttatttc
ggtatgaaatcgccgatgatgcagaccgatgaagggcagatcgaagaatcttattccatc
tcggcaggtctcgacttcccgtccgtcgggccacagcatgcgcatctgaacagcatcggc
cgtgcagaatatgtgtcgattaccgatgacgaagcgctggaagccttcaaaaccctgtgt
cgtaacgaagggattatcccggcgctcgaatcttctcatgcccttgcctatgcactgaaa
atgattaaagaggacccggaaaaagagcagttactggtggttaacctttccggtcgcggt
gacaaagacatcttcaccgttcacgatattttgaaagcacgaggggaaatctga

DBGET integrated database retrieval system