KEGG   Enterobacter sp. 638: Ent638_2208Help
Entry
Ent638_2208       CDS       T00507                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ent  Enterobacter sp. 638
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ent638_2208
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ent638_2208
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ent638_2208
Enzymes [BR:ent01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ent638_2208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2400074..2400883
Genome map
AA seq 269 aa AA seqDB search
MERYDNAFTELKARKEGAFVPFVTLGDPGPEQSLKIIDTLIAAGADALELGIPFSDPLAD
GPTIQSATLRAFASGVTPTQCFEMLATVRQKYPTIPIGLLMYANLVFNRGIDEFYAECAR
VGVDSVLIADVPIEESAPFRQAAMRHNIAPIFICPPNADDELLRQIASHGRGYTYLLSRA
GVTGAENKAAVPLHHLVEKLAEYHAAPPLQGFGISSPEQVTAAIEANAAGAISGSAIVKI
IEKNVDKPDQMLTELRDFVTVMKAATRHA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgataacgcatttactgaactcaaagcccgcaaggaaggcgcttttgtt
cccttcgtcacgcttggcgatccagggccagagcagtcgctgaaaattatcgacaccctg
attgccgccggtgccgatgcgcttgaactggggatccccttctccgatccgctggcggat
ggccccaccattcaaagcgcaacactgcgtgcatttgcatccggcgtgacgccaacgcag
tgttttgaaatgctggcgactgtgcgtcagaaatatcccacgattccgattggcctgctg
atgtacgccaacctggtgttcaaccgtgggatcgatgagttttacgccgagtgcgcgcgc
gtcggtgtggattccgtgctgatcgctgacgtaccgattgaagagtctgcgccgtttcga
caggcggcgatgcgtcacaacatcgcgccgattttcatctgcccaccgaatgccgatgac
gaattattacgccagattgcctctcacgggcgcggctatacctatttgctgtcccgcgcg
ggcgtgaccggcgctgaaaacaaagctgccgttccgctgcatcacctggtcgaaaaacta
gctgaataccacgccgcgccaccgttacagggtttcggtatttcttcgccggagcaagtg
accgctgccatcgaggctaatgcggcgggtgccatttcgggttcggccattgtgaaaatt
atcgagaaaaacgtcgataagcccgatcagatgctgacggaacttcgcgacttcgttacc
gtaatgaaggccgcgactcgccacgcataa

DBGET integrated database retrieval system