KEGG   Enterobacter sp. 638: Ent638_2248Help
Entry
Ent638_2248       CDS       T00507                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ent  Enterobacter sp. 638
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2435913..2436449)
Genome map
AA seq 178 aa AA seqDB search
MGNRAKLSAAMISLIAAGASAPILFDQFISEKEGNALVAVVDPGGVWSLCHGVTVIDGKS
VIKGQRATEAQCKKVNAIERDKALAWVDRNIKVPLTEPQKVGIASFCPYNIGPGKCYPST
FYQRINAGDGKGACEAIRWWIKDGGRDCRLTKGQKNGCYGQVERRDQESALACWGLDK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacagagcgaagcttagtgctgcaatgatctccctgattgctgctggcgcatca
gcaccgattttatttgatcagttcattagtgagaaagaaggtaacgcgctcgttgctgtc
gtcgatccgggcggtgtctggtcattgtgccacggtgtaactgtcattgatggcaagtcg
gtcatcaaaggccagcgagctactgaggcgcagtgcaagaaagtgaatgccatcgagcgc
gacaaggcgcttgcatgggtggaccgaaatatcaaagtgccgctcactgaaccgcagaaa
gttggcatcgcatcgttttgtccttacaacatcggccctggtaaatgctacccgtcgacg
ttctatcagcgcattaacgctggcgacggtaaaggcgcatgcgaagcaattcgctggtgg
attaaagatggtggccgagactgccgactgaccaaaggccagaagaatgggtgttatggt
caggtggaaagacgggaccaggagagcgcgctggcgtgctgggggctggataaatga

DBGET integrated database retrieval system