KEGG   Enterobacter sp. 638: Ent638_2307Help
Entry
Ent638_2307       CDS       T00507                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ent  Enterobacter sp. 638
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ent638_2307
   00052 Galactose metabolism
    Ent638_2307
   00500 Starch and sucrose metabolism
    Ent638_2307
   00520 Amino sugar and nucleotide sugar metabolism
    Ent638_2307
Enzymes [BR:ent01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Ent638_2307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2485614..2486522)
Genome map
AA seq 302 aa AA seqDB search
MAALNSKVTKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGNEPVAVILPDVILDEFESDLSQDNLAEMIKRFDETGSSQIMVEPVADVTAYGV
VDCKGVELKPGESVPMVGVVEKPKADVAPSNLAVVGRYVLSAEIWPLLAKTPPGAGDEIQ
LTDGIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNSLGEEFKAWLKDTMGI
KN
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctaaattcgaaagttacaaaggccgttatcccagtagcgggattgggaacc
aggatgctaccggctactaaggccattccgaaagaaatgctgccgttggtcgataaacca
ttaatccagtatgtcgttaatgagtgtattgccgcgggtattacggaaattgtactggta
acgcattcgtctaaaaactctatcgaaaaccatttcgataccagttttgaacttgaagcc
atgctggaaaaacgtgtcaaacgtcagctgctggaagaggtgcaatctatttgtccgccg
cacgtcaccattatgcaggtgcgtcagggtctggccaaaggcctgggccatgcagtgctg
tgcgcgcatccagttgtgggtaatgaacctgtcgctgttatcctgccagacgtgattctg
gacgagttcgaatccgacctgtctcaggacaacctcgcagagatgattaaacgctttgac
gaaaccggcagcagccaaatcatggtagagccagttgcagatgtgacggcctacggtgta
gttgactgcaaaggcgttgagctgaagccgggtgaaagtgtgccgatggtaggcgtggtc
gagaagccaaaagcagacgttgcaccgtctaacctcgcagtggtgggacgctatgtgctg
agcgcagagatttggccgctgctggcgaaaacccctccaggagcgggtgatgaaatccaa
ctcaccgatggtattgatatgctgatcgagaaagagacggttgaggcttaccacatgaaa
ggtaagagccacgattgcggtaataaactcggttatatgcaggctttcgttgaatatggt
atccgtcacaattcactgggcgaagaatttaaagcctggttgaaagacacgatgggtatt
aaaaactaa

DBGET integrated database retrieval system