KEGG   Enterobacter sp. 638: Ent638_2340Help
Entry
Ent638_2340       CDS       T00507                                 

Gene name
ipk
Definition
(RefSeq) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
  KO
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ent  Enterobacter sp. 638
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ent638_2340 (ipk)
Enzymes [BR:ent01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Ent638_2340 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2527847..2528716
Genome map
AA seq 289 aa AA seqDB search
MMTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFVDYGDTISIEPRQDGEIHLLTPVDDV
ASEDNLIVRAARLLVQAAANSGRLPEHYGADIGVEKRLPMGGGLGGGSSNAATVLVALNH
LWGCGFSQDELATLGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLIAHPGVSIP
TPVIFNDPELPRNTPVRSIETLLKCEFGNDCEVIARKRFRKVDAALSWLLEYAPSRLTGT
GSCVFAEFDTESAARQVLEQAPEWLHGFVARGMNTSPLQQTILAQTEFR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgatgacccaatggccctccccggcaaaactaaacctgtttttgtacattaccggccag
cgtgctgacggatatcacacgctgcagacgctgtttcagtttgttgattatggcgacacg
atctccatcgagccgcgtcaggacggagaaatccatttactgaccccagttgacgacgtc
gccagtgaagacaacctgatcgtgcgcgctgcacgtctcctggtacaagcggcggcaaac
tcaggccgcttgcctgagcattacggggctgatattggcgtcgagaaacgcctgccgatg
ggcggtggactgggtggcgggtcgtcaaatgcagcaacggtgctggtcgcgctgaatcat
ctgtggggctgcgggttttctcaggacgagctggccacgctggggctgacgctgggagcc
gatgttccggtatttgttcgcggtcatgccgcctttgccgaaggtgtcggcgaaattctt
actcccgtcgatccgccagaaaaatggtatcttatcgcacacccgggtgtgagcattccc
actccggttatttttaacgatccggaattgccgagaaacacaccagtgcggtcaatagag
acgttactaaaatgtgaattcggcaacgattgcgaggttatcgcaagaaaacgttttcgt
aaggttgatgcggcgctttcctggctgttagaatatgcgccgtcgcgcctgactggcaca
ggttcgtgtgtttttgctgaatttgacaccgaatccgccgctcgtcaggtgctagagcaa
gctccggaatggctgcacggttttgtagctcgtgggatgaacacgtcccccctacagcag
accattctggcgcagactgagtttcggtga

DBGET integrated database retrieval system