KEGG   Enterobacter sp. 638: Ent638_2340Help
Entry
Ent638_2340       CDS       T00507                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ent  Enterobacter sp. 638
Pathway
ent00900  Terpenoid backbone biosynthesis
ent01100  Metabolic pathways
ent01110  Biosynthesis of secondary metabolites
ent01130  Biosynthesis of antibiotics
Module
ent_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ent638_2340
Enzymes [BR:ent01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Ent638_2340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABP61009
UniProt: A4WBC9
Position
2527847..2528716
Genome map
AA seq 289 aa AA seqDB search
MMTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFVDYGDTISIEPRQDGEIHLLTPVDDV
ASEDNLIVRAARLLVQAAANSGRLPEHYGADIGVEKRLPMGGGLGGGSSNAATVLVALNH
LWGCGFSQDELATLGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLIAHPGVSIP
TPVIFNDPELPRNTPVRSIETLLKCEFGNDCEVIARKRFRKVDAALSWLLEYAPSRLTGT
GSCVFAEFDTESAARQVLEQAPEWLHGFVARGMNTSPLQQTILAQTEFR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgatgacccaatggccctccccggcaaaactaaacctgtttttgtacattaccggccag
cgtgctgacggatatcacacgctgcagacgctgtttcagtttgttgattatggcgacacg
atctccatcgagccgcgtcaggacggagaaatccatttactgaccccagttgacgacgtc
gccagtgaagacaacctgatcgtgcgcgctgcacgtctcctggtacaagcggcggcaaac
tcaggccgcttgcctgagcattacggggctgatattggcgtcgagaaacgcctgccgatg
ggcggtggactgggtggcgggtcgtcaaatgcagcaacggtgctggtcgcgctgaatcat
ctgtggggctgcgggttttctcaggacgagctggccacgctggggctgacgctgggagcc
gatgttccggtatttgttcgcggtcatgccgcctttgccgaaggtgtcggcgaaattctt
actcccgtcgatccgccagaaaaatggtatcttatcgcacacccgggtgtgagcattccc
actccggttatttttaacgatccggaattgccgagaaacacaccagtgcggtcaatagag
acgttactaaaatgtgaattcggcaacgattgcgaggttatcgcaagaaaacgttttcgt
aaggttgatgcggcgctttcctggctgttagaatatgcgccgtcgcgcctgactggcaca
ggttcgtgtgtttttgctgaatttgacaccgaatccgccgctcgtcaggtgctagagcaa
gctccggaatggctgcacggttttgtagctcgtgggatgaacacgtcccccctacagcag
accattctggcgcagactgagtttcggtga

DBGET integrated database retrieval system