KEGG   Enterobacter sp. 638: Ent638_2454Help
Entry
Ent638_2454       CDS       T00507                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ent  Enterobacter sp. 638
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ent00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ent638_2454
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Ent638_2454
Enzymes [BR:ent01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Ent638_2454
Two-component system [BR:ent02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Ent638_2454
Bacterial motility proteins [BR:ent02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ent638_2454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2647572..2648621)
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGIDFLEKLMRLRPMPVVMVSSLTGKGSEITLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKIRTASRAKLTAHTPVSAPVAIKAGPLLSSEKLLVIGASTGGTEAIRHVLQPLPL
SSPGILITQHMPPGFTRSFAERLNKLCQISVKEAEDGERVLPGHAYIAPGDKHMELARSG
ANYQIKIHDGPPVNRHRPSVDVLFHSVAKHAGRNAVGVILTGMGNDGAAGMLAMHKAGAW
TIAQNEASCVVFGMPREAINMGGVSEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaataagggtgttatctgtcgatgattccgcgctgatgcgccagatcatgacg
gagattatcaacagtcatagcgatatggagatggtggccactgcacccgatcctctggta
gcgcgtgatttaattaaaaaattcaaccccgacgtactcacgctggatgtggaaatgccg
cgtatggacggcattgattttcttgaaaaattaatgcgtctgcgcccaatgcccgtggtg
atggtctcttctctgacggggaaaggctcagaaatcaccctgcgtgcgctggagttgggg
gcgatagatttcgtcactaaaccgcagctcggcattcgtgaagggatgttagcgtacagc
gaaatgatcgctgagaagattcgtaccgcctcgcgggcgaaactgacggcacatacgcct
gtttcggctcccgtggcgattaaagctgggccgcttctgagctcggaaaagttgctggtg
attggcgcatcaaccggaggaacagaggcaattcgccatgtactccagccattgccgctt
tcaagtcccggtattcttattacccagcatatgccgccaggctttacccgttcgttcgct
gagcgtctgaataagctgtgtcagattagcgtgaaagaagcggaagacggcgaacgtgtc
ctgccgggtcatgcgtatattgcaccgggtgacaaacatatggagttggcgcgcagtggc
gctaactaccagatcaaaattcatgacggaccgccggttaaccggcatcgtccgtcagtg
gatgtgctgtttcattcggtggcgaaacatgcggggcgcaatgccgttggggttatcctg
acgggaatgggcaacgatggtgcggccggaatgctagcgatgcataaggctggcgcatgg
acgattgcgcagaatgaagcaagttgtgtggtgttcggcatgccgcgcgaggccatcaat
atgggtggcgtgagcgaagtggtcgatcttagccaggtaagccagcaaatgctggcgaaa
atcagtgccggacaggcaatacgtatttaa

DBGET integrated database retrieval system