KEGG   Enterobacter sp. 638: Ent638_2699Help
Entry
Ent638_2699       CDS       T00507                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ent  Enterobacter sp. 638
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ent00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ent00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2911796..2912278)
Genome map
AA seq 160 aa AA seqDB search
MTAFYQHTATSLGGQIISMNDYAGKVVLVVNTASLCGFTPQYGGLEALYKKYAAQGLVVL
GFPCNQFGKQEPGGADEIAQTCHINYGVSFPMFEKVEVNGTAAHPVFRYLKSELPGVLGG
RIKWNFTKFLIGRDGKPLKRFAPITAPEKMEAAIRDALGV
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccttttatcaacatacagccaccagccttggcggccagattatctctatgaac
gactacgcgggtaaggtggttctggtggttaataccgccagcctgtgtgggttcacgcca
caatatggcggccttgaagcgctttacaaaaaatacgccgcccaaggtttggtggtgctt
ggtttcccctgcaaccagttcggaaaacaagaacccggcggtgccgacgaaattgcgcag
acctgtcacattaactacggggtaagcttcccgatgttcgagaaagtcgaggtcaacgga
accgcagcgcatccggtgtttcgttatctcaaaagcgagttgcccggcgtgctgggaggg
cggatcaagtggaacttcacgaaattcctgattggacgcgacggtaaaccgctcaagcgt
tttgcaccgatcaccgccccggagaaaatggaagccgcaatccgtgatgcgcttggagtt
taa

DBGET integrated database retrieval system