KEGG   Enterobacter sp. 638: Ent638_2814Help
Entry
Ent638_2814       CDS       T00507                                 

Definition
(GenBank) 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
  KO
K02551  
2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [EC:2.2.1.9]
Organism
ent  Enterobacter sp. 638
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Menaquinone biosynthesis, chorismate => menaquinone
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Ent638_2814
Enzymes [BR:ent01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     Ent638_2814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3049844..3051514)
Genome map
AA seq 556 aa AA seqDB search
MSVSSFNRRWAAVILEALTRHGVRHVCIAPGSRSTPLTLAAAENRAFIHHTHFDERGLGH
LALGLAKVSKAPVAVIVTSGTAVANLYPALIEAGLTGEKLVLLTADRPPELIDCGANQAI
RQPGIFASHPAEALSLPRPTQDIPASWLVSTLDHAMGTLRHGALHINCPFAEPLYGELND
TGVEWQQTLGDWWQSDKPWLRAQTHLQSGQQRDWFHWRQKRGVILAGRMTAAEGKQVAEW
AKTLGWPLIGDVLSQTGQPLPCADLWLGNAKAVTELARAQIVIQLGSSLTGKRVLQWQST
CEPEEYWLVDSLEGRLDPAHHRGRRLVSTIGDWLEDHPAEKRQAWATDIPELSRLAWDLT
TQQCERFGEAELAHRIRQYLPDQGQLFVGNSLVVRLIDALSKLPAGYPVYSNRGASGIDG
LISTAAGVQRASTKPTLAIVGDLSALYDLNALALLRQASAPFVLIVVNNNGGQIFSLLPT
PQSERERFYLMPQNVQFEHAAAMFSLKYHRPQSWSELDDAMSTAWRQPGATLIELVVNDS
DGAQKLQHLLAQVSHL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaagttcttttaaccgacgctgggcggcggtcattcttgaagccctgactcgc
catggcgtcaggcatgtgtgtattgcaccgggctcacgctccacgccgctaacgcttgcg
gcggcggaaaaccgcgcgtttattcatcacacccattttgatgaacgtggccttggccat
ctggctctggggctggcgaaagtcagcaaagcgcccgtggcggtcattgtcacgtccggt
acggccgtcgcgaatctctatccagcgctgattgaggcggggttaacgggcgaaaaactg
gtgctgctcaccgcagaccgaccgcctgagctgattgactgcggcgccaatcaggcgatt
cgtcagcccggtatttttgcctcgcaccctgcagaggcactttcattgccgcgtcccact
caggacattcctgccagttggttggtttcaacgcttgatcatgccatgggcacactccgt
cacggcgcgctgcacatcaactgcccgtttgctgaaccgctgtatggcgagctgaacgat
accggcgttgaatggcagcaaacccttggcgactggtggcaaagcgacaaaccgtggctg
cgcgcacaaacgcatctgcaaagcggacagcagcgcgactggttccactggcgacagaag
cgcggcgtgatcctcgccgggcgtatgactgccgctgagggtaaacaggtcgctgaatgg
gccaaaacgctgggttggccgctgattggcgatgtactttcgcaaaccggtcagccgctg
ccgtgcgcagatttatggctgggcaacgcaaaagcggttaccgaacttgcacgggcgcaa
attgtgattcagttaggctcaagcctcaccggaaaacgcgtgttgcaatggcaatccacc
tgcgagccggaagagtactggctggttgactcgctggaagggcggctcgatccggctcat
catcgtgggcgtcgcctggtcagtaccattggcgactggctggaagatcacccagcggaa
aaacgtcaagcctgggcgacggacatccccgagctttctcgcctggcgtgggacctcacc
acacagcaatgcgagcgttttggcgaggcggaactggcgcatcggattcgtcagtatctg
cccgaccagggtcagctctttgtcggaaacagcctggtggtccgcctgattgatgcgctt
tctaagctaccagccggatatccggtttacagcaaccgtggtgccagcggtatcgacggg
ctgatttccaccgccgcgggcgttcagcgcgccagcaccaaaccaacactcgcgattgtt
ggtgatctctccgcgttatatgacctcaacgcgctggccttgctgcgccaggcgtcggca
ccgttcgtgctgattgtggtcaacaataacggcggacaaattttctctctgctgccgacg
ccgcaaagtgagcgcgaacgtttctacctgatgccgcaaaatgtgcagttcgagcatgcg
gccgcgatgttcagcctcaaatatcatcgcccgcaaagctggtcagagctggacgatgcc
atgagcaccgcctggcggcagccgggtgccacgctcattgagctggtggtgaatgattct
gacggggcacaaaagctgcaacatctcctcgcgcaggtgagccatctatga

DBGET integrated database retrieval system