KEGG   Enterobacter sp. 638: Ent638_3051Help
Entry
Ent638_3051       CDS       T00507                                 

Definition
pyridoxine 5'-phosphate synthase
Orthology
K03474  
pyridoxine 5-phosphate synthase [EC:2.6.99.2]
Organism
ent  Enterobacter sp. 638
Pathway
Vitamin B6 metabolism
Metabolic pathways
Module
Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Class
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:ent00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3320783..3321514)
Genome map
AA seq 243 aa AA seqDB search
MAELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVKI
LRQTLDTRMNLEMAVTEEMLAIACETKPHFCCLVPEKRQEVTTEGGLDVAGQQDKMRDAC
KRLADAGILVSLFIDADFDQIKAAAAVGAPYIEIHTGCYADAEDEVAQAKELARIAKAAT
YAASLGLKVNAGHGLTYHNVKAIAQIPEMFELNIGHAIIGRAVMSGLKEAVSEMKRLMLE
ARQ
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattactgttaggcgtcaacattgatcacatcgccacactgcgtaacgcgcgt
ggtacggcatatcctgatccggttcaggcggcgtttattgccgagcaggcgggcgcagac
ggtatcaccgttcatttgcgtgaagatcgccgccatatcactgaccgagatgtgaaaatt
ctgcgccagacgctggatacccgcatgaatctggaaatggcggtgacggaagagatgctg
gcgattgcctgcgaaaccaaacctcatttctgctgcctggtgccggaaaaacgtcaggaa
gtgaccaccgaaggtgggctggatgtcgccgggcagcaggataaaatgcgcgatgcctgc
aaacgcctcgctgacgccggaattctggtttccctgtttatcgacgccgattttgaccag
atcaaagcggctgccgcggtcggcgcgccgtacatcgaaattcacaccggctgctatgcc
gatgccgaagacgaagtcgctcaggctaaagagcttgcccgtatcgcgaaagccgccact
tacgctgccagcttgggcttgaaggttaatgccgggcacggtctgacgtatcacaacgtc
aaagcgattgcgcaaattccagagatgtttgagctgaatatcggtcacgccattataggt
cgggcagtgatgagcggtctcaaagaagccgtgtcggaaatgaaacgtctgatgctggaa
gcgcgtcagtaa

DBGET integrated database retrieval system