KEGG   Enterobacter sp. 638: Ent638_3214Help
Entry
Ent638_3214       CDS       T00507                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ent  Enterobacter sp. 638
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3501508..3502134)
Genome map
AA seq 208 aa AA seqDB search
MVSQRVQALLNQLRTQGIADERVLEAIAQVPREKFVDEAFEHKAWENVALPIGQGQTISQ
PYMVARMTELLELTPESRVLEIGTGSGYQTAILAHLVHHVCSVERIKGLQWHARRRLKQL
DLHNVSTRHGDGWLGWQARAPFDAIIVTAAPLEIPAALLSQLDNGGILVLPVGDEHQLLK
RVRRRDGEFIIDTVEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaagtcaacgtgtacaagcacttctgaatcaattgcgcacccagggcatcgccgac
gagcgtgtgctggaggctatcgcgcaggtaccgcgcgagaaatttgtggatgaggcgttt
gaacacaaagcgtgggaaaacgtggccttacccataggacaggggcagacaatttctcag
ccctatatggtcgcgcgcatgacggaattactggagctgacaccggagtctcgcgttctc
gaaattggaacgggatcgggctatcagacggcgattctggcgcatctcgttcatcatgtc
tgctctgttgaaagaatcaaaggcttgcaatggcatgcgcgccgtcgtcttaaacagctt
gatttacataatgtttcaacacgtcacggtgacgggtggctggggtggcaagctcgcgct
ccgtttgacgctattatcgtgacggcagcaccgcttgaaatccccgctgcgctcttgtcg
cagctggataatggcggcattctcgtgttacccgtgggcgatgaacatcagctgttaaaa
cgtgttcgtcggcgggatggcgagtttatcatcgatactgtagaagccgtgcgttttgtg
cctctcgtgaagggagagctggcctga

DBGET integrated database retrieval system