KEGG   Enterobacter sp. 638: Ent638_3262Help
Entry
Ent638_3262       CDS       T00507                                 

Gene name
recD
Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ent  Enterobacter sp. 638
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ent00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ent638_3262 (recD)
Enzymes [BR:ent01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Ent638_3262 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3555681..3557504)
Genome map
AA seq 607 aa AA seqDB search
MTMQALLLEAVEQRVLRRLDAQFAMMVAGNDQPAVMLAAAILSRDAGEGHVCLPLSRLVV
DDKTPAPLQACFALVGEAVNWQDVLLQSHGVSTGDLPTPLILCAERLYLNRMWRNELAIA
RFFNESNQPLPYDPPQLHQTLNALFDDSGSVNWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMAGEQKCRIRLAAPTGKAAARLTESLGGALQKLPLNDAQRTLFPNEASTL
HRLLGAQPGSQRLRYHAGNPLHLDVLVVDEASMIDLTMMSRLIDALPPHARVIFLGDRDQ
LASVEAGAVLGDICHYASAGYTLPRAQELSELTGCSIEGTSDPVAGALRDSLCLLQKSYR
FGSDSGIGQLAAAVNRGDRNAIRAVFNGDFQDIEKKPLQTGEEYLAMLEDAVQGYQRFLH
CVHQQESPEVVIAAFGEYQLLCALREGPFGVTGLNERLEQTLSQKRKIIRQPHSRWYEGR
PVMISRNDSALGLFNGDIGIALDRGQGLRVWFQMPDGSVKSVQPSRLPEHETAWAMTVHK
SQGSEFDHAVLILPAQMSPVITRELVYTAITRARKRLSLYADERVLAQAVTTRIERRSGL
SAIFESV
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgcaagcgttactgctcgaggccgtcgaacaacgtgttctgcgccgacttgat
gcacagtttgccatgatggtggcgggcaatgaccagccagccgtcatgctggccgccgcc
attctcagtagggatgcgggtgaagggcatgtttgtttaccgctctcgcgtctggtggtc
gacgataaaaccccggcccccttacaagcgtgttttgcgctagtgggcgaagcggttaac
tggcaggacgtcctgttgcaatcccatggcgtcagtacaggcgatctgccgacgccactc
atcctgtgcgctgaacggctctatctcaatcgcatgtggcgaaatgagctggcgattgcc
cgcttcttcaatgagtcaaatcaaccgctgccttatgatcctccccagttacatcaaacg
ctgaatgctttatttgatgacagtgggtcggtgaactggcaaaaagttgcggccgcggtt
gcgctaacgcgccgtatctccgtgatttcgggcggaccaggaacgggtaaaaccaccacg
gtggcaaaattgttggccgctctgattcaaatggcgggtgaacaaaaatgccggattcgt
ctggctgcgccgacaggaaaagccgctgcgcgactgaccgaatcgctgggcggggcgttg
caaaaactcccgctcaatgatgcgcaacgcaccttgttcccgaatgaagccagcacgttg
caccgtttactgggtgcccagccgggcagtcagcgtctgcgttatcacgcgggcaacccg
ctgcatctggatgtgctggtggtggatgaagcctccatgatcgatctgacgatgatgtcg
cgtctgattgacgccttgccgccccatgccagagtgattttcctcggcgatcgcgatcag
ctcgcctcggttgaagcgggcgcggtgctgggtgatatctgccattatgccagtgcgggc
tatacgttaccgcgcgcgcaggagttgtcggaactcactgggtgttcgattgaaggcaca
tccgatccggtagcgggcgcgttacgcgacagtctctgtttactgcaaaaaagctatcga
ttcggcagtgattccgggatcgggcagcttgccgcggcggtgaatcgcggcgacagaaat
gccatccgcgcggtgtttaacggtgattttcaagacatagaaaaaaagccgctgcaaacg
ggcgaagagtatctggcgatgcttgaagatgcggtgcagggttatcagcgttttctgcac
tgcgtgcaccagcaggaatcgccggaagtggttatcgctgcttttggcgaatatcaactc
ctgtgcgcgcttcgtgaggggccgttcggcgtgacagggcttaatgaacgacttgagcag
acgctttctcagaaacgtaaaatcatccgccagccgcattcgcgctggtatgaagggcgg
cctgtgatgatttcacgcaacgacagcgctctcggcctgttcaacggtgatattggtatt
gccctcgatcgcgggcaggggcttcgcgtgtggttccagatgccggatggtagcgtgaaa
tcggtccagccaagccgtttgccggaacacgaaacggcatgggcgatgacggtgcataaa
tcgcaaggctctgagtttgatcacgcggtgttgattctgcctgcgcagatgtcgccagtc
attacgcgtgagctggtttacaccgctatcacccgcgcccgtaagcgattgtcgctctac
gctgatgaacgcgtgctggcgcaggcggtcacgacgcgcattgaacgtcgcagtgggtta
agtgccatttttgagtcagtctga

DBGET integrated database retrieval system