KEGG   Enterobacter sp. 638: Ent638_4052Help
Entry
Ent638_4052       CDS       T00507                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ent  Enterobacter sp. 638
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ent638_4052 (tpiA)
   01230 Biosynthesis of amino acids
    Ent638_4052 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ent638_4052 (tpiA)
   00051 Fructose and mannose metabolism
    Ent638_4052 (tpiA)
   00562 Inositol phosphate metabolism
    Ent638_4052 (tpiA)
Enzymes [BR:ent01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ent638_4052 (tpiA)
Exosome [BR:ent04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ent638_4052 (tpiA)
  Exosomal proteins of bladder cancer cells
   Ent638_4052 (tpiA)
  Exosomal proteins of melanoma cells
   Ent638_4052 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4405697..4406464
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELIANLRKELAGVTGCAVAIAPPDIYLDLAKHAADGSHIV
LGAQNVDVNLSGAFTGETSAEMLKDIGAKYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LIPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGASAFEGVVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKVAEQVIIQYGGSVNAANAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gagctgatcgcgaacctgcgtaaagagctggctggcgtgacaggctgtgctgtagcgatc
gctccaccagacatttatctggatctggctaaacacgctgctgacggcagccacatcgtt
ctgggtgcacagaacgttgacgttaacctctctggcgcattcaccggcgaaacctccgct
gaaatgctgaaagatatcggcgcaaaatacatcatcatcggccactctgagcgtcgtact
tatcacaaagagtctgacgagctgatcgcgaagaaattcgctgtgctgaaagagcagggt
ctgattccggttctgtgcattggtgaaaccgaagcagaaaacgaagcaggcaaaaccgaa
gaagtgtgcgcacgtcagatcgacgctgtgctgaaaacccagggcgcaagcgcgttcgaa
ggcgtggttatcgcttacgaaccagtctgggcaatcggtactggcaaatctgcgacccct
gcgcaggcacaggctgttcacaaatttatccgtgaccacattgcgaaagccgacgcgaaa
gtggctgagcaagtgatcattcagtacggcggttccgttaacgcggcaaacgctgctgag
cttttcacccagccggacatcgacggcgcgctggttggcggtgcttccctgaaagctgac
gctttcgcggtgatcgttaaagcagcagaagccgctaaacaggcttaa

DBGET integrated database retrieval system