KEGG   Enterobacter sp. 638: Ent638_4056Help
Entry
Ent638_4056       CDS       T00507                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ent  Enterobacter sp. 638
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ent638_4056
   01230 Biosynthesis of amino acids
    Ent638_4056
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ent638_4056
   00030 Pentose phosphate pathway
    Ent638_4056
   00051 Fructose and mannose metabolism
    Ent638_4056
   00052 Galactose metabolism
    Ent638_4056
  Energy metabolism
   00680 Methane metabolism
    Ent638_4056
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Ent638_4056
Enzymes [BR:ent01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ent638_4056
Protein phosphatases and associated proteins [BR:ent01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ent638_4056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4409964..4410926)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEIFGVYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFREEHIRQVAIENMKKRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVVPEVEFSREDLVNEIKAGIAKGKKHAIVAITEHICDVDELAKYIETETK
RETRATVLGHIQRGGSPGPYDRILASRMGAYAIDLLLQGHGGRCVGIQNEKLVHHDIVDA
IESMKRPFKGDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgccccaggcatgaacgcggca
attcgtggtgttgtgcgtgcagcattgacggaaggtctggaaatttttggcgtttatgac
ggctacctgggtctgtatgaagaccgcatggttcagctcgatcgctacagcgtatctgac
atgattaaccgtggcggcaccttcctcggttccgcgcgcttcccggaattccgcgaagag
cacatccgccaggtggcaatcgaaaacatgaaaaaacgcggcctggacgcgttagtggtt
atcggcggtgacggttcttatatgggcgcaaaacgcctgactgaaatgggcttcccatgt
atcggtctgccgggcaccatcgataacgacatcaaaggcaccgactacaccattggtttc
tttactgccctcggtactgttgttgaagcgattgaccgtctgcgtgacacctcttcttct
caccagcgtatttccatcgttgaagtgatgggccgttactgcggcgacctgaccctggct
gcggccattgcaggcggctgtgagttcatcgttgttccagaagtggaattcagccgtgaa
gatctggtcaacgaaatcaaagccggtatcgcgaaaggcaaaaaacacgccatcgtggcg
attaccgaacacatctgtgatgtggacgagctggcaaaatacatcgaaaccgaaaccaag
cgcgaaacgcgcgctacggttctgggtcacatccagcgcggcggttccccgggtccttac
gatcgtattctggcctcccgcatgggcgcatacgctatcgatctgctgctgcagggtcat
ggcggtcgttgcgtcggtattcagaacgaaaaactggttcaccatgacatcgttgacgcg
atcgaaagcatgaagcgtccgttcaaaggtgactggctggactgcgcgaaaaaactgtat
tga

DBGET integrated database retrieval system