KEGG   Enterobacter sp. 638: Ent638_4074Help
Entry
Ent638_4074       CDS       T00507                                 

Definition
lactaldehyde reductase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ent  Enterobacter sp. 638
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:ent01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ent00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ent00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ent00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:ent00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:ent00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4430085..4431233
Genome map
AA seq 382 aa AA seqDB search
MSFMLALPKISLHGAGAIGDMVNLVANKQWGKALIVTDGQLVKMGLLDSLFTALDAHQMS
YHLFDDVFPNPTEALVQKGFAAYQDADCDYLIAFGGGSPIDTAKAIKILTANPGPSTAYS
GVGKVKNTGVPLVAINTTAGTAAEMTSNAVIIDTARQVKEVIIDSNIIPDIAVDDASVML
DIPASVTAATGMDALTHAIEAYVSVGAHPLTDANALEAIRLIALWLPKAVDDGHNLHARE
QMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIIENFNRPNAVARFA
LVAQAMGVETRGMSDDAASQSAIQAIRDLSTRVGIPSGFSQLGVTKADIEGWLDKALADP
CAPCNPRTASRDEVRELYLEAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagctttatgttggcgcttcccaaaatcagcctgcacggcgcgggcgcaatcggcgat
atggtcaatctggtggcaaacaagcagtggggaaaagcactgattgttaccgacgggcag
ttggtgaaaatggggctgctcgacagcctcttcaccgcgctggacgcccatcagatgtct
tatcatctgttcgatgacgtgtttccaaatccaaccgaagcgctggtgcagaaagggttc
gcggcgtatcaggatgcggactgcgattacctgatcgctttcggcggcggcagcccgatt
gataccgcgaaggcgattaaaatcctgacggcgaatcctggcccgtccaccgcttattct
ggcgtcgggaaagtcaaaaacacgggcgtgccgctggtggcgatcaataccactgcgggc
acggcggcggagatgaccagcaacgcggtgattatcgataccgcgcgccaggtgaaagaa
gtcattattgattccaatattatcccggatatcgccgtcgatgacgccagcgtgatgctc
gatattcccgcgtccgtcactgccgcaacgggcatggatgcgctgacgcacgccatcgaa
gcctatgtgtctgtcggcgcgcacccgctgaccgacgccaacgcgctggaagctattcgc
ctgatcgcgctgtggctgccgaaagcggttgatgacgggcataacctgcacgcccgtgag
cagatggcttttgggcagtatctggcgggcatggcgtttaacagcgccggtctgggtctg
gtgcacgctctggcgcatcagccaggcgcgacgcacaacctgccgcacggcgtgtgcaac
gctattctcctgccgatcatcgaaaactttaaccgccctaatgcggtcgcacgttttgcc
ctcgtggcccaggcgatgggtgtcgagacgcgtggaatgagcgacgacgcggcaagccag
tcagcgattcaggccatacgcgacctgagcacgcgcgtcggtattccatcgggattcagc
cagcttggcgtcaccaaagcggatatcgaaggctggctcgacaaagcgctcgccgacccg
tgcgcaccgtgcaacccgcgtaccgccagccgcgacgaggttcgcgagctgtatctggag
gcattatga

DBGET integrated database retrieval system