KEGG   Enterobacter sp. 638: Ent638_4074Help
Entry
Ent638_4074       CDS       T00507                                 

Definition
lactaldehyde reductase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ent  Enterobacter sp. 638
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Ent638_4074
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ent638_4074
  Lipid metabolism
   00071 Fatty acid degradation
    Ent638_4074
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ent638_4074
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ent638_4074
   00626 Naphthalene degradation
    Ent638_4074
Enzymes [BR:ent01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ent638_4074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4430085..4431233
Genome map
AA seq 382 aa AA seqDB search
MSFMLALPKISLHGAGAIGDMVNLVANKQWGKALIVTDGQLVKMGLLDSLFTALDAHQMS
YHLFDDVFPNPTEALVQKGFAAYQDADCDYLIAFGGGSPIDTAKAIKILTANPGPSTAYS
GVGKVKNTGVPLVAINTTAGTAAEMTSNAVIIDTARQVKEVIIDSNIIPDIAVDDASVML
DIPASVTAATGMDALTHAIEAYVSVGAHPLTDANALEAIRLIALWLPKAVDDGHNLHARE
QMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIIENFNRPNAVARFA
LVAQAMGVETRGMSDDAASQSAIQAIRDLSTRVGIPSGFSQLGVTKADIEGWLDKALADP
CAPCNPRTASRDEVRELYLEAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagctttatgttggcgcttcccaaaatcagcctgcacggcgcgggcgcaatcggcgat
atggtcaatctggtggcaaacaagcagtggggaaaagcactgattgttaccgacgggcag
ttggtgaaaatggggctgctcgacagcctcttcaccgcgctggacgcccatcagatgtct
tatcatctgttcgatgacgtgtttccaaatccaaccgaagcgctggtgcagaaagggttc
gcggcgtatcaggatgcggactgcgattacctgatcgctttcggcggcggcagcccgatt
gataccgcgaaggcgattaaaatcctgacggcgaatcctggcccgtccaccgcttattct
ggcgtcgggaaagtcaaaaacacgggcgtgccgctggtggcgatcaataccactgcgggc
acggcggcggagatgaccagcaacgcggtgattatcgataccgcgcgccaggtgaaagaa
gtcattattgattccaatattatcccggatatcgccgtcgatgacgccagcgtgatgctc
gatattcccgcgtccgtcactgccgcaacgggcatggatgcgctgacgcacgccatcgaa
gcctatgtgtctgtcggcgcgcacccgctgaccgacgccaacgcgctggaagctattcgc
ctgatcgcgctgtggctgccgaaagcggttgatgacgggcataacctgcacgcccgtgag
cagatggcttttgggcagtatctggcgggcatggcgtttaacagcgccggtctgggtctg
gtgcacgctctggcgcatcagccaggcgcgacgcacaacctgccgcacggcgtgtgcaac
gctattctcctgccgatcatcgaaaactttaaccgccctaatgcggtcgcacgttttgcc
ctcgtggcccaggcgatgggtgtcgagacgcgtggaatgagcgacgacgcggcaagccag
tcagcgattcaggccatacgcgacctgagcacgcgcgtcggtattccatcgggattcagc
cagcttggcgtcaccaaagcggatatcgaaggctggctcgacaaagcgctcgccgacccg
tgcgcaccgtgcaacccgcgtaccgccagccgcgacgaggttcgcgagctgtatctggag
gcattatga

DBGET integrated database retrieval system