KEGG   Enterobacter sp. 638: Ent638_4112Help
Entry
Ent638_4112       CDS       T00507                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
ent  Enterobacter sp. 638
Pathway
ent00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ent638_4112
Enzymes [BR:ent01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Ent638_4112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase Aldolase
Motif
Other DBs
NCBI-ProteinID: ABP62765
UniProt: A4WGD5
Position
complement(4474831..4475775)
Genome map
AA seq 314 aa AA seqDB search
MDTSYMKTAGNLVVLGSINADHILNLESFPTPGETVTGNQYQVAFGGKGANQAVAAGRSG
ANIAFIACTGDDDTGERVRKQLESDNIDIAPVSVVAGESTGVALIFVNAEGENVIGIHAG
ANAALNIERVEAQREIIARAEALLMQLESPVESVLAAAKIAHENHTTVVLNPAPARVLSD
ELLALVDIITPNETEAEKLTGIRVENDDDAARAAKALHEKGIDTVIITLGSRGVWASVNG
EGRRVPGFKVKAVDTIAAGDTFNGALVTALLEGKPMDDAIRFAHAAAAIAVTRKGAQPSV
PWRKEIDEFLIQQR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggacacctcatacatgaaaaccgcaggcaatctcgtcgtccttggcagtatcaatgcc
gatcacattcttaaccttgaatctttccccactccgggtgaaaccgtcaccggtaatcag
tatcaggtggctttcggtggtaagggtgcaaaccaggccgtagcggccggtcgcagtggt
gcgaatattgcctttattgcctgtacgggtgatgacgataccggcgaacgtgttcgcaag
cagctggaaagcgacaacatcgatattgcgccagtgagcgtggtcgctggggaatcaacc
ggcgtggcgttaattttcgtcaacgcagaaggtgagaatgttatcggtattcacgcaggg
gcaaacgcggcgctgaacattgaacgcgttgaagcgcagcgtgaaattattgcccgtgct
gaagccttgctgatgcagttggagtctccggtcgaaagcgtgctggcggcggcaaaaatt
gcgcatgaaaatcataccactgtcgtacttaaccccgcgccagcgcgtgtattatcagac
gaactgttggcgctggtggacatcattacgccaaacgaaaccgaagctgaaaagctgacg
ggtattcgtgtggaaaacgatgacgacgccgcgcgagccgctaaggcattgcacgagaaa
ggcatcgacaccgtgattatcacgctcggtagccgtggcgtgtgggcgagcgttaacggt
gaaggccgtcgcgtgcccggctttaaggttaaagccgttgacactatcgcggcgggagac
acttttaatggtgcgctggtcacggcgttgctggaaggtaagccgatggatgatgccatt
cgcttcgcccatgccgcagccgcgattgcggtgacgcgtaaaggtgctcagccttccgtt
ccatggcgcaaagagattgatgaatttttgattcagcagaggtaa

DBGET integrated database retrieval system