KEGG   Enterobacter sp. E20: NI40_011475Help
Entry
NI40_011475       CDS       T04118                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
enx  Enterobacter sp. E20
Pathway
enx00052  Galactose metabolism
enx00500  Starch and sucrose metabolism
enx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    NI40_011475
   00500 Starch and sucrose metabolism
    NI40_011475
Enzymes [BR:enx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     NI40_011475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 Reg_prop
Motif
Other DBs
NCBI-ProteinID: ALL17754
Position
complement(2433218..2434624)
Genome map
AA seq 468 aa AA seqDB search
MTLPSRWPAILQAVMKGQPRALADSHYPQWHPAPVTGLMNDPNGFLWFAGRYHLFYQWNP
LDCEHRFKCWGHWSSADLVHWQHEPLALMPDEEYDRNGCYSGSAVDNQGVLTLCYTGNVK
FDDGSRTAWQCLAVEQPDGTFTKLGAVLALPEGYTGHVRDPKVWQHDGMWYMVLGAQDLQ
KRGKVLLFKSADLHAWASCGEIAGHGVNGLTDAGYMWECPDLFALDGTHILISCPQGLAR
EPHRYLNTYPATWTSGAFDYSNAAFDHGDLHELDAGFEFYAPQTTLAEDGRRILIGWMGV
PDGEEMLQPTRAHGWMHQMTCPRELRYRQGRLWQTPARELAALREDEQRWQGRASEAPDL
DATRLEFELSASQVNVDFGGALRLTVDEQGIRLERASLKTGETLTRYWRGDVTHLRVLCD
RSSVEIFINHGEGVMSSRYFPDHPARVRFEGASDITLRYWSLRACMIE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacgttaccttcccgctggcctgcgatcctgcaggccgttatgaaaggtcagccgcgg
gcgctggcggatagccactatccgcagtggcaccccgcgccggtgacggggctgatgaac
gatcccaacgggtttctctggtttgccggccgctaccacctgttctatcagtggaacccg
ctggactgcgagcatcggtttaaatgctgggggcactggagctctgcggacctggtgcac
tggcagcatgagccgctggcgctgatgccggatgaagagtatgaccgcaacggctgctac
tccggtagcgccgtggataaccagggcgtcctgaccttgtgctacaccggcaacgttaag
tttgatgacggcagccgcacggcctggcagtgcctcgccgtggaacagccggacgggacc
tttacgaagctgggggcggtgctggcgctgccggaaggctacaccggacacgtgcgcgac
ccgaaggtgtggcagcacgacgggatgtggtacatggtgctcggcgcgcaggatctgcaa
aagcgcggcaaggtgctgctgtttaaatcagccgatttgcacgcctgggcgtcctgcggg
gaaatcgccggtcacggggttaacggcctgacggacgcgggttatatgtgggagtgtccg
gacctgttcgcgctcgacggaacgcacatcctgattagctgtccgcaggggctggcgcgc
gagccgcatcgctatctcaacacctatccggcgacctggacgagcggggcgtttgattat
tcgaatgccgcgttcgatcacggcgacctgcacgagctggacgcgggctttgagttttac
gctccgcaaacgacgctggcggaagacggccgacgcattctgatcggctggatgggcgta
ccggacggggaagagatgcttcagccaacccgggcgcacggctggatgcaccagatgacc
tgcccgcgcgaattacgctatcgccaaggcaggctctggcagaccccggcgcgcgagctg
gcggcgctgcgtgaagatgagcagcgctggcaggggcgcgccagcgaggcgccggacctg
gacgcgacgcgcctggagtttgagctgagcgcatcgcaggtgaatgtcgattttggcggc
gcgctgcgtctaacggttgatgagcagggcatacgtcttgagcgcgcgagcctgaaaacc
ggtgaaacgctgacccgctactggcggggcgacgtcactcatttgcgcgttctgtgcgac
cgctccagcgttgaaattttcatcaatcacggtgaaggggtgatgagcagccgctatttt
cctgaccatccggcccgggtgcgattcgaaggtgcgtccgatatcacattacgctactgg
tcgctgcgcgcctgcatgatagaatga

DBGET integrated database retrieval system