KEGG   Escherichia coli O7 K1 CE10: CE10_0003Help
Entry
CE10_0003         CDS       T01999                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
eoc00260  Glycine, serine and threonine metabolism
eoc00750  Vitamin B6 metabolism
eoc01100  Metabolic pathways
eoc01110  Biosynthesis of secondary metabolites
eoc01120  Microbial metabolism in diverse environments
eoc01230  Biosynthesis of amino acids
Module
eoc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:eoc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CE10_0003 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CE10_0003 (thrC)
Enzymes [BR:eoc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CE10_0003 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AEQ10861
UniProt: A0A0E0V080
Structure
PDB: 

Jmol
Position
3732..5018
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
LRDQLHPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
RKLMMNHQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacaatctgaaagatcacaatgagcaggtcagctttgcgcaagccgtaacc
caggggttgggcaaaaatcaggggctgtttttcccgcacgacctgccggaattcagcctg
actgaaattgatgagatgctgaagctggattttgtcacccgcagtgcgaagatcctctcg
gcgtttattggtgatgaaatcccgcaggaaatcctggaagagcgcgtacgcgcggcgttt
gccttcccggctccggtcgccaatgttgaaagcgatgtcggttgtctggaattgttccac
gggccaacgctggcatttaaagatttcggcggtcgctttatggcacaaatgctgacccat
attgcgggcgataagccagtgaccattctgaccgcgacatccggtgatactggagcggca
gtggctcatgctttctacggtttaccgaatgtgaaagtggttatcctctatccacgaggc
aaaatcagtccactgcaagaaaaactgttctgtacattgggcggcaatatcgaaactgtt
gccatcgacggcgatttcgatgcctgtcaggcgctggtgaagcaggcgtttgatgatgaa
gaactgaaagtggcgctggggctaaactctgctaactccattaacatcagccgtttgctg
gcgcagatttgctactactttgaagctgttgcgcagctgccgcaggaagcgcgcaaccag
ctggttgtctcggtgccaagcggaaacttcggcgatttgacggcgggtctgctggcgaag
tcactcggtctgccggtgaagcgttttatcgctgccactaacgtgaacgataccgtgccg
cgtttcctgcacgacgggcagtggtcacccaaagcgactcaggcgacgttatccaacgcg
atggacgtgagtcaaccgaacaactggccgcgtgtggaagagttgttccgccgcaaaatc
tggcaactgaaagagctgggttatgcagccgtagatgatgaaaccacgcaacagacaatg
cgtgagttaaaagaactgggctatacctcggagccgcacgctgccgtagcttatcgtgcg
ctgcgtgaccagttgcatccaggcgaatatggcttgttcctcggcaccgcgcatccggcg
aaatttaaagagagcgtggaagcgattctcggtgaaacgttggatctgccaaaagagctg
gcagaacgtgctgatttacccttgctttcgcataacctgcccgccgattttgctgcgttg
cgtaaattgatgatgaatcatcagtaa

DBGET integrated database retrieval system