KEGG   Escherichia coli O7 K1 CE10: CE10_0243Help
Entry
CE10_0243         CDS       T01999                                 

Gene name
proB
Definition
(GenBank) gamma-glutamate kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
eoc00330  Arginine and proline metabolism
eoc00332  Carbapenem biosynthesis
eoc01100  Metabolic pathways
eoc01130  Biosynthesis of antibiotics
eoc01230  Biosynthesis of amino acids
Module
eoc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:eoc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CE10_0243 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CE10_0243 (proB)
Enzymes [BR:eoc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CE10_0243 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEQ11089
UniProt: A0A0E0V0U6
Structure
PDB: 

Jmol
Position
267359..268462
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
LRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPR
SNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPG
VIGDVMEGISVGTLFHAQATPLENRKRWIFGAPPAGEITVDEGATAAILERGSSLLPKGI
KSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYGPVAVH
RDDMITR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtggtaaaactcggcaccagtgtgctaacaggcggatcg
cgccgcctgaaccgtgcccatatcgttgaacttgttcgccagtgcgcgcagttacatgcc
gccgggcatcggattgttattgtgacgtcgggcgcgatcgccgccggacgtgagcacctg
ggttacccggaactgccagcgactatcgcctcgaaacaattgctggcggcggtagggcag
agtcgactgattcaactgtgggaacagctgttttcgatttatggcattcacgtcgggcaa
atgctgctgacccgtgctgatatggaagaccgtgaacgcttcctgaacgcccgcgacacc
ttgcgtgcactgctcgataacaacatcgttccggtaatcaatgagaacgatgctgtcgct
actgcagagattaaggtcggtgataacgataacctttctgcgctggcggcgattctggcg
ggtgccgataaactgttgctgctgaccgatcaaaaaggtttgtacaccgctgacccgcgc
agcaatccgcaggcagaactgattaaagatgtttacggcattgatgacgcactgcgcgcg
attgccggtgacagcgtttcaggcctcggaactggcggcatgagtaccaaattgcaggcc
gcggacgtggcttgccgtgcgggtatcgacaccattattgccgcgggcagcaagccgggc
gttattggtgatgtgatggaaggcatttccgtgggtacgctgttccatgcccaggcgact
ccgcttgaaaaccgtaaacgctggattttcggtgcgccgccggcgggtgaaatcacggta
gatgaaggggcaactgccgccattcttgaacgcggcagctccctgttgccgaaagggatt
aaaagcgtgactggcaacttctcgcgtggtgaagtcatccgcatttgcaacctcgaaggt
cgcgatatcgctcacggcgtcagtcgttacaacagcgatgcattacgccgtattgccgga
caccactcgcaagaaattgatgcaatactgggatatgaatacggcccggttgccgttcac
cgtgatgacatgattacccgttaa

DBGET integrated database retrieval system