KEGG   Escherichia coli O7 K1 CE10: CE10_1557Help
Entry
CE10_1557         CDS       T01999                                 

Gene name
ycjM
Definition
putative glucosyltransferase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:eoc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CE10_1557 (ycjM)
Enzymes [BR:eoc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     CE10_1557 (ycjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1565633..1567312
Genome map
AA seq 559 aa AA seqDB search
MKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITLRRKKHWDESDVVLITYADQFHS
NDLKPLPTFNQFYPQWLQSIFSHVHLLPFYPWSSDDGFSVIDYQQVASEAGEWQDIQQLG
ECSHLMFDFVCNHMSAKSEWFKNYLQQQPGFEDFFIAVDPQTDLSVVTRPRALPLLTPFQ
MRDHSTRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLEKGAEYVRLDAVGFMWKEPGT
SCIHLEKTHLIIKLLRSIIDDVAPGTVIITETNVPHRDNIAYFGNGDDEAHMVYQFSLPP
LVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLPESEILALVEA
LQQEGALVNWKNNPDGTRSPYEMNVTYMDALNRRESSDEERCARFILAHAILLSFPGVPA
IYIQSILGSRNDYAGVEKLGYNRAINRKKYYSEEITTELNNKTTLRHAVYHELSRLIKIR
RSHNEFHPDNDFTIDTVNSSVMCIQRSNADGNCLTGLFNVSENIQHINITDLHGRDLISE
VDIVGNEITLRPWQVMWIK
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaaattacggattacctggacgaaatctacggtggaacatttaccgcaact
catttacagaaacttgtaacgcgtcttgagagtgcgaaacgattaattacactgcgacgt
aaaaaacactgggatgaaagtgatgtcgtgttaatcacctatgccgatcaatttcacagt
aatgatttaaaaccactacccacatttaatcagttttaccctcaatggctgcaaagcatt
ttttcacatgttcatttattacctttttatccatggtcatctgatgatggcttttcggta
attgattatcaacaggtcgccagtgaagcgggggagtggcaggatattcagcaactcggt
gaatgcagtcatttaatgtttgattttgtctgcaaccatatgtcggcaaaaagtgaatgg
tttaaaaactatttacaacagcagccaggttttgaagatttttttattgccgttgacccg
caaaccgatctcagcgtcgtcactcgcccgcgtgcgttaccgttattaacgccattccag
atgcgcgatcattcaacgcgccatttatggaccacctttagtgacgatcaaattgacctg
aattaccgtagccctgaagtgttactggcgatggtggatgtattgctgtgctacctggaa
aagggcgcagaatatgtccgtctggatgccgttggctttatgtggaaagagccgggaaca
agctgcatccatctggaaaaaacacatctgattatcaaactgttacggtcgattattgat
gacgtagcaccaggtacagtgatcattaccgagaccaatgttccgcacagagacaacatt
gcttactttggcaacggtgatgacgaagcgcatatggtgtaccagttctcgctgccgccg
ctggtgctgcatgcggtgcaaaaacagaacgttgaggcgctttgtgcgtgggcgcaaaac
ctgacactaccttccagcaacaccacctggtttaacttcctcgcctctcacgatggcatc
gggcttaacccactgcgtggcttgctacccgaaagcgaaatattagcgctggtcgaggca
ttacagcaggaaggggcattagttaactggaaaaataatcccgacggtacgcgtagcccg
tatgaaatgaatgtcacttatatggatgcgttaaaccgccgcgagagtagcgatgaagaa
cgttgcgccaggtttatccttgcccatgcgattttgttaagtttccccggtgtgccagcg
atatatattcaaagtattctgggctcgcgtaatgattacgcaggtgtcgaaaaactggga
tataaccgtgcgattaaccgtaaaaaatattacagtgaagagatcacgaccgaactgaac
aataaaacgacgttaaggcacgcggtatatcatgaattgtcgcgactaattaaaattcgt
cgaagtcataacgagtttcatccagataatgattttaccatcgacacagttaattcatcc
gtaatgtgtattcaaagaagcaacgcggatggtaattgtctgacaggattgtttaatgtc
agtgaaaatattcagcatataaatattactgacctgcacggtcgggatctgattagtgaa
gttgatatagtgggtaatgaaataacgctgcgcccctggcaggttatgtggattaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system