KEGG   Escherichia coli O7 K1 CE10: CE10_1667Help
Entry
CE10_1667         CDS       T01999                                 

Gene name
adhP
Definition
ethanol-active dehydrogenase/acetaldehyde-active reductase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eoc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CE10_1667 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CE10_1667 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    CE10_1667 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CE10_1667 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CE10_1667 (adhP)
   00626 Naphthalene degradation
    CE10_1667 (adhP)
Enzymes [BR:eoc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CE10_1667 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1699503..1700513)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagttgttacgaaggatcatcatgttgacgttacggataaaacactgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgacaaaaccggcgtgattctgggacacgaaggt
attggtgtggtggcagaagttggcccaggtgtcacttcattaaaaccaggcgatcgtgcc
agcgtggcgtggttttacgaaggatgcggtcattgcgaatactgtaatagtggtaacgaa
acgctctgccgttcagttaaaaatgccggatacagcgttgatggcgggatggcggaagaa
tgcatcgtggtcgccgattacgcggtaaaagtgccagatggcctggactcggcggcggcc
agcagcattacctgtgcgggggtcaccacctacaaagcggtgaagctgtcaaaaattcgt
ccagggcaatggattgctatctacggtcttggcggtctgggtaacctcgccctgcaatac
gcgaagaatgtctttaacgcgaaagtgatcgccattgatgtcaatgatgagcagttaaaa
ctggcaaccgaaatgggcgctgatttagcgattaactcacgcaccgaagacgccgccaaa
attgtgcaggagaaaactggtggcgctcacgcagcagtggtgacagcggtagctaaagct
gcgtttaactcggcggtggatgctgtccgtgcaggtggtcgtgtcgtggctgtcggtctg
ccgccggagtctatgagcctggacatcccgcggctggtgctggatggcattgaagtggtc
ggttcgctggtcggcacgcgccaggatttaactgaagccttccagtttgccgccgaaggc
aaagtggtaccgaaggtcgccctgcgtccgttagcggacatcaacacaatctttactgag
atggaagaaggcaaaatccgtggccgtatggtgattgatttccgccgctaa

DBGET integrated database retrieval system