KEGG   Escherichia coli O7 K1 CE10: CE10_1878Help
Entry
CE10_1878         CDS       T01999                                 

Gene name
folM
Definition
dihydromonapterin reductase, NADPH-dependent, dihydrofolate reductase isozyme
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eoc00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:eoc00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1896161..1896883
Genome map
AA seq 240 aa AA seqDB search
MGKTQSLPILITGGGRRIGLALAWHFINQKQPVIVSYRTHYPTIDGLIKAGAQCIQADFS
TNDGVMAFADEVLKSTHGLRAILHNASAWMAEKPGAPLTDVLACMMQIHVNTPYLLNHAL
ERLLRGHGHAASDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNSIA
PSLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSLPLDGGRHLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaacccagtccttgccaatattaattactggcggaggtcgccgcatcggcctc
gccctcgcatggcatttcattaatcaaaagcaaccggtgattgtcagctatcggacgcac
tatcccaccattgatggactgattaaggcaggtgcgcagtgtattcaggctgatttttcg
accaacgacggtgtgatggcgtttgccgatgaagtactaaaaagcacccatggtctgcgt
gctattttgcataacgccagcgcgtggatggcggaaaaaccgggagcgccactgaccgac
gtactggcttgcatgatgcagatccacgttaataccccatacctgctcaaccatgctctg
gaaagattactgcgtgggcacggacacgccgccagcgatatcattcactttaccgattat
gtggtggagcgcggtagcgacaaacatattgcctatgctgcaagcaaagcggcactggat
aatatgacccgctcgtttgcccgcaagctggcaccggaagtgaaagtgaattctattgcg
ccatcgctgatcctgtttaatgaacatgatgatgccgaatatcgacaacaggcgctgaat
aaatcactgatgaaaaccgcgcctggcgagaaagaagtgatcgacctggtcgattactta
cttaccagctgctttgtcaccggacgcagtctcccacttgatggcggtcgtcatctgcgt
taa

DBGET integrated database retrieval system