KEGG   Escherichia coli O7 K1 CE10: CE10_1990Help
Entry
CE10_1990         CDS       T01999                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:eoc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CE10_1990 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CE10_1990 (btuE)
Enzymes [BR:eoc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CE10_1990 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2014117..2014668)
Genome map
AA seq 183 aa AA seqDB search
MQDSILTTVVKDIDGEVTTLEKYAGNVLLIVNVASKCGLTPQYEQLENIQKAWADRGFVV
LGFPCNQFLEQEPGSDEEIKTYCTTTWWVTFPMFSKIEVNGEGRHPLYQKLIAAAPTAVA
PEESGFYARMVSKGRAPLYPDDILWNFEKFLVGRDGLVIQRFSPDMTPEDPIVMESIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattccattctgacgaccgtagtgaaagatatcgacggtgaagtgaccacgctg
gagaagtacgccggtaatgtgctgttgattgtcaatgtcgcctcaaagtgtggcttaacg
ccgcaatatgagcagttggagaatattcagaaagcctgggccgatcgtggttttgtggtg
ctgggattcccgtgcaaccagtttctggaacaagaaccgggcagcgatgaagagattaaa
acttactgtaccaccacatggtgggtgacgttcccgatgttcagtaagattgaagttaat
ggcgaaggacgccatccgctgtatcaaaaattgattgccgcagcgccgaccgcagtcgcg
ccggaagagagcggattctatgcccgtatggtcagcaaaggtcgtgcaccgctgtaccct
gatgatattttatggaattttgagaaatttttagttggcagggacggattggtcatccag
cgtttttccccggatatgacgccggaagatcccattgtgatggaaagcattaaactggcg
ttggcaaaataa

DBGET integrated database retrieval system