KEGG   Escherichia coli O7 K1 CE10: CE10_2002Help
Entry
CE10_2002         CDS       T01999                                 

Gene name
pfkB
Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eoc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CE10_2002 (pfkB)
   01230 Biosynthesis of amino acids
    CE10_2002 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CE10_2002 (pfkB)
   00030 Pentose phosphate pathway
    CE10_2002 (pfkB)
   00051 Fructose and mannose metabolism
    CE10_2002 (pfkB)
   00052 Galactose metabolism
    CE10_2002 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    CE10_2002 (pfkB)
Enzymes [BR:eoc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CE10_2002 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2026778..2027707
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFP
AGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALSEDEFRQ
LEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGN
IELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLKEMVRFGVAAGSAATLNQGTRLCSHDDT
QKIYAYLSR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacacttgcgccctctctcgatagcgcaacaattaccccg
caaatttatcccgaaggaaagctgcgctgtaccgcaccggtattcgaacccggaggcggc
ggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttcccg
gcgggtggtgcgaccggcgaacatctggtttcactgttggcagatgaaaatgtccccgtc
gctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagcaagc
ggtgagcagtatcgttttgtcatgccaggcgcggcattaagtgaagatgagtttcgccag
cttgaagagcaagttctggaaattgaatccggtgctatcctggtcataagcggaagcctg
ccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaacaaggg
attcgctgcatcgtcgacagttctggcgaagcgttaagtgcagcactggcgattggtaat
atcgagttggttaagcctaaccaaaaagaactcagtgcgctagtgaatcgcgaactcacc
cagccagacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaacga
gttgtcgtttccctgggtccacaaggggcgttgggcgttgatagtgaaaactgcattcag
gttgtgccaccaccggtgaaaagccagagcaccgttggcgctggtgacagcatggtcggc
gcgatgacactgaaactggcagaaaatgcctctcttaaagagatggtccgttttggcgta
gctgcggggagtgcagccacactcaatcagggaacacgcctgtgctcccatgacgataca
caaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system