KEGG   Escherichia coli O7 K1 CE10: CE10_2048Help
Entry
CE10_2048         CDS       T01999                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:eoc00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2070595..2071236
Genome map
AA seq 213 aa AA seqDB search
MPPRALLLVDLQNDFCAGGALAVPEGDSTVDVANRLIDWCQSRGEAVIASQDWHPANHGS
FASQHGVEPYTLGQLDGLPQTFWPDHCVQNSEGAQLHPLLKQKAIAAVFHKGENPLVDSY
SAFFDNGRRQKTALDDWLRDHEIDELIIMGLATDYCVKFTVLDALQLGYKVNVITDGCRG
VNIQPQDSAHAFMEMSAAGATLYTLADWEETQE
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgccccctcgcgccctgttactggtcgatttacaaaatgatttctgtgctggtggcgcg
ctcgccgtgccggaaggtgacagtacggtggatgtcgctaaccgcctgattgactggtgc
cagtcgcgcggtgaagcggttatcgccagtcaggactggcatccggcgaatcacggcagt
tttgccagtcagcacggtgtagagccttatacgctgggccaactcgacggtttgccacaa
accttctggcccgatcactgtgtgcagaacagtgaaggcgcacaattacatccgttactg
aagcaaaaagcgatcgcagcggtgttccataaaggcgaaaatcctttagttgacagttac
agtgccttttttgataacggccgtcggcagaaaactgcgctcgatgactggttacgcgat
catgaaatcgatgaattgatcattatgggcctggctactgactattgcgtgaagtttacc
gtgctggacgcgttacagttaggctataaggtgaacgtgattaccgatggttgtcgtggc
gtaaatatccagccacaggacagtgcgcacgcgtttatggagatgtcagcagctggggca
acgctatatacgctggcagactgggaagaaacgcaggagtaa

DBGET integrated database retrieval system