KEGG   Escherichia coli O7 K1 CE10: CE10_2060Help
Entry
CE10_2060         CDS       T01999                                 

Gene name
yeaD
Definition
(GenBank) conserved protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
eoc00010  Glycolysis / Gluconeogenesis
eoc01100  Metabolic pathways
eoc01110  Biosynthesis of secondary metabolites
eoc01120  Microbial metabolism in diverse environments
eoc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:eoc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CE10_2060 (yeaD)
Enzymes [BR:eoc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CE10_2060 (yeaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEQ12847
UniProt: A0A0E0V5L5
Position
2082560..2083444
Genome map
AA seq 294 aa AA seqDB search
MIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFALQGAHLLSWKPAGEEEVLW
LSNNTPFKNGVAIRGGVPVCWPWFGPAAQQGLPAHGFARNLPWTLKSHREDADGVALTFE
LTQSEETKKFWLHDFTLLAHFRVGKACEIDLEAHGEFETTSALHTYFNVGDITKVSVSGL
GDRFIDKVNDAKEDVLTDGIQTFPDRTDRVYLNPQDCSVINDEALNRIIAVGHQHHLNVV
GWNPGPALSVSMGDMPDDGYKTFVCVETAYASETQKVTKEKPAHLAQSIRVAKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatttttgcccttccggtcatcgaacaaatctcccctgtcctctcccgt
cgtaaactggatgaactggacctcattgtggtcgatcatccccaggtaaaagcctctttt
gcattacagggcgcacaccttctctcatggaaacctgcgggtgaagaagaagttctgtgg
ttgagcaataacacaccgttcaaaaatggcgtcgctattcgcggtggcgtaccggtttgc
tggccgtggtttggtccggctgcacaacaaggtctgcctgcgcacggttttgcccgcaac
ctgccgtggacgctgaaatcacatcgtgaagatgctgatggcgtagcgctgacttttgaa
ttgacacaaagcgaagagacgaaaaaattctggctacacgactttacgctattagcgcat
ttccgcgtgggtaaagcctgtgaaatcgatcttgaagcacacggcgaatttgaaaccacc
tctgccctgcatacctactttaacgtgggtgatatcactaaggtaagcgtcagtggactg
ggcgatcgcttcattgataaagtgaatgacgcgaaagaagatgtactgaccgacggtatt
cagaccttccctgaccgtaccgatcgcgtgtatctgaatccgcaagattgcagcgtaatt
aatgacgaagcgctgaatcgtattatcgccgtaggccaccagcatcatctgaacgttgta
ggctggaacccaggaccggcgctttcagttagcatgggcgatatgccggatgatggctac
aagacctttgtttgtgtagaaacagcttacgcctcagaaacgcaaaaagtcaccaaagag
aaacctgcacatctggcgcaatccattcgcgttgcgaaacgttaa

DBGET integrated database retrieval system