KEGG   Escherichia coli O7 K1 CE10: CE10_2169Help
Entry
CE10_2169         CDS       T01999                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:eoc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CE10_2169 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CE10_2169 (cheB)
Enzymes [BR:eoc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CE10_2169 (cheB)
Two-component system [BR:eoc02022]
 CheA family
  CheA-CheYBV
   CE10_2169 (cheB)
Bacterial motility proteins [BR:eoc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CE10_2169 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2185396..2186445)
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTAAKASLAAHKPLSAPTTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPALLITQHMPPGFTRSFADRLNKLCQIGVKEAEDGERVLPGHAYIAPGDRHMELARSG
ANYQIKIHDGPAVNRHRPSVDVLFHSVAKQAGRNAVGVILTGMGNDGAAGMLAMRQAGAW
TLAQNEASCVVFGMPREAINMGGVCEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatcagggtgttatctgtcgatgattcggcactgatgcgccagatcatgaca
gaaatcatcaacagccatagcgacatggaaatggtggcgactgcccctgatccgctggtt
gcgcgtgatttgattaagaaattcaatcccgatgtattgacgctggatgttgaaatgccg
cggatggacggactggatttcctcgaaaaattaatgcgtttgcgtccaatgcccgttgtg
atggtttcttccctgaccggcaaagggtcagaagtcacgctgcgcgcgctggagctgggg
gcgatagattttgtcaccaaaccgcaactgggtattcgcgaaggaatgctggcgtatagc
gaaatgattgctgaaaaggtgcgtacggcagcaaaggcgagccttgcagcacataagcca
ttgtcggctccgacaacgctgaaggcggggccgttgttgagttctgaaaaactgattgcg
attggtgcttcaacgggtggaactgaggcaattcgtcacgtactgcaaccgttgccgctt
tccagtccggcactgttaattacccagcatatgccgcccggtttcacccgctcttttgcc
gacagacttaataagctttgccagatcggagttaaagaagccgaagacggagagcgcgtc
ttgccgggacatgcctatatcgcgccgggcgatcggcatatggagctggcgcgtagtggc
gcaaattatcaaatcaaaattcacgatggcccggcggttaatcgccatcggccatcggtt
gatgtgttgttccattctgtggccaaacaggcggggcgtaatgcggttggggtgatccta
accggtatgggcaacgacggcgcggcgggaatgttggcgatgcgtcaggcgggggcatgg
acccttgcgcaaaacgaagcaagttgcgtggtgttcggcatgccgcgcgaggccatcaat
atgggtggtgtctgcgaagtggtcgatcttagccaggtaagtcagcaaatgctggcaaaa
attagtgccggacaggcgatacgtatttaa

DBGET integrated database retrieval system