KEGG   Escherichia coli O7 K1 CE10: CE10_2355Help
Entry
CE10_2355         CDS       T01999                                 

Gene name
rfbC
Definition
dTDP-4-deoxyrhamnose-3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eoc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CE10_2355 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CE10_2355 (rfbC)
Enzymes [BR:eoc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     CE10_2355 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2374018..2374563)
Genome map
AA seq 181 aa AA seqDB search
MNVIKTEIPDVLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKSTKGVIRG
LHFQLPPYSQAKLVRCVVGEVYDVVVDIRKDSKTFGKWVGVNLSAENKRQLWIPEGFAHG
FEVISEVAHFLYKTNNYYNATMEKGIRWDDEYLAINWKEKKAIISEKDMKQPSFRELFEK
V
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaattaaaactgaaattcctgatgtattaatatttgaaccaaaagtatttggg
gatgagcgtggtttttttatggaaagcttcaatcagaaagttttcgaagaagctgtgggg
cggaaggttgaatttgttcaggataaccattctaagtctactaaaggagtaattagagga
ttacattttcaattaccaccttattcacaggcaaaattagtacgctgtgtagtaggtgag
gtatatgacgttgttgttgatataaggaaagattctaaaacttttggcaaatgggtcggt
gtaaatctttctgctgaaaacaaacgacagttgtggattccagaaggattcgcccatggt
tttgaagtgattagtgaagttgctcattttttatacaaaacaaataattattataatgca
actatggaaaaaggtataagatgggatgatgaatatttagctattaattggaaagaaaaa
aaagcgataatctctgagaaagacatgaaacaaccatcattcagagaactttttgagaaa
gtttaa

DBGET integrated database retrieval system