KEGG   Escherichia coli O7 K1 CE10: CE10_2460Help
Entry
CE10_2460         CDS       T01999                                 

Gene name
arrQ4
Definition
Qin prophage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eoc  Escherichia coli O7:K1 CE10
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2495523..2496056)
Genome map
AA seq 177 aa AA seqDB search
MNTKIKYGLSAAVLALIAAGAPAPDILDQFLDEKEGNHTTAYRDGAGIWTICRGAIMVDG
KPVVPGMKLSKEKCDQVNAIERDKALAWVEKNIRVPLTEPQKAGIASFCPYNIGPGKCFP
STFYRRINAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVSRRDQESALACWGIDR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaaaatcaaatacggcctgtcggctgccgttctggcgctgattgccgctggt
gcgcctgcgcctgacattctcgaccagtttctggatgaaaaggaaggcaaccacaccacg
gcataccgtgatggtgcaggtatctggaccatctgccgtggtgccatcatggtggatggc
aaacctgtcgttccgggcatgaagttgtcgaaggaaaaatgcgaccaggttaacgccatt
gagcgtgataaagcgctggcgtgggtggagaaaaacatcagagtgccgctgaccgaaccc
cagaaagcggggatcgcgtcattctgtccgtacaacattggtcccggtaagtgtttcccg
tcgacgttttacagacgaattaatgcaggtgatcgaaaaggtgcctgcgaagcgattcgc
tggtggattaaggacggtggcagagactgccgtattcgctcaaataactgttacggtcag
gtatcccgtcgtgaccaggagagcgcgctggcgtgctggggtatcgacagataa

DBGET integrated database retrieval system