KEGG   Escherichia coli O7 K1 CE10: CE10_2524Help
Entry
CE10_2524         CDS       T01999                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eoc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CE10_2524 (folE)
Enzymes [BR:eoc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CE10_2524 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2548437..2549105)
Genome map
AA seq 222 aa AA seqDB search
MPSLSKEAALVHEALVARGLETPLRPPVHEMDNETRKSLIAGHMTEIMQLLNLDLADDSL
METPHRIAKMYVDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRHEFLRAVRHHN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccatcactcagtaaagaagcggccctggttcatgaagcgttagttgcgcgaggactg
gaaacaccgctgcgcccgcccgtgcatgaaatggataacgaaacgcgcaaaagccttatt
gctggtcatatgaccgaaatcatgcagctgctgaatctcgacctggctgatgacagtttg
atggaaacgccgcatcgcatcgctaaaatgtatgtcgatgaaattttctccggtctggat
tacgccaatttcccgaaaatcaccctcattgaaaacaaaatgaaggtcgatgaaatggtc
accgtgcgcgatatcaccctgaccagcacctgtgaacaccattttgttaccatcgatggc
aaagcgacggtggcttatatcccgaaagattcggtgatcggtctgtcaaaaattaaccgt
attgtgcagttctttgcccagcgtccgcaggtgcaggaacgtctgacccagcaaattctc
attgcgctacaaacgctgctgggcaccaataacgtggctgtctctatcgacgcggtgcat
tactgcgtgaaagcgcgtggcatccgcgacgcaaccagtgccacaacaacgacctctctt
ggtggattgttcaaatccagtcagaatacgcgccacgaatttctgcgcgctgtgcgtcat
cacaactga

DBGET integrated database retrieval system