KEGG   Escherichia coli O7 K1 CE10: CE10_2672Help
Entry
CE10_2672         CDS       T01999                                 

Gene name
alaA
Definition
(GenBank) valine-pyruvate aminotransferase 2
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
eoc00220  Arginine biosynthesis
eoc00250  Alanine, aspartate and glutamate metabolism
eoc00290  Valine, leucine and isoleucine biosynthesis
eoc01100  Metabolic pathways
eoc01110  Biosynthesis of secondary metabolites
eoc01130  Biosynthesis of antibiotics
eoc01210  2-Oxocarboxylic acid metabolism
eoc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eoc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CE10_2672 (alaA)
   00290 Valine, leucine and isoleucine biosynthesis
    CE10_2672 (alaA)
   00220 Arginine biosynthesis
    CE10_2672 (alaA)
Enzymes [BR:eoc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     CE10_2672 (alaA)
    2.6.1.66  valine---pyruvate transaminase
     CE10_2672 (alaA)
Amino acid related enzymes [BR:eoc01007]
 Aminotransferase (transaminase)
  Class I
   CE10_2672 (alaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AEQ13435
UniProt: A0A0E0V8J5
Structure
PDB: 

Jmol
Position
2716733..2717950
Genome map
AA seq 405 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
TPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgaaaaatccagcaaattagagaatgtctgttacgacatccgtggtccg
gtgctgaaagaagcaaaacgcctggaagaagaaggtaacaaggtactgaaactgaacatc
ggcaaccctgccccgttcggttttgacgcgccagatgaaatcctcgttgacgtgattcgc
aacctgcctaccgctcaagggtattgcgattccaaagggctttactccgcgcgtaaagcc
atcatgcagcactaccaggctcgtggcatgcgtgatgttaccgtggaagatatttacatc
ggcaatggtgtatcggagcttatcgttcaggcaatgcaggcattgctgaacagcggggac
gaaatgttggttcctgcacctgattacccactatggaccgcggcggtttcgctctccagc
ggtaaagcggtgcattatctttgcgatgaatcctctgactggttcccggaccttgatgat
attcgcgctaaaattacgcctcgtacgcgtgggatcgttattatcaacccaaataaccca
actggcgcggtatattccaaagagcttttaatggagatagtggagattgcacgtcagcat
aatctcattatcttcgccgatgaaatttatgacaaaattctctacgacgacgctgagcat
cactcaattgcgccgctggcacctgatctgctgaccattacctttaacggactgtcgaaa
acgtaccgcgttgcaggcttccgtcaggggtggatggtgttgaacgggccgaaaaaacac
gccaaaggctacatcgaaggtctggaaatgctggcttcaatgcgcctgtgtgctaacgtt
cctgcgcaacacgccattcagaccgcgctgggcggttatcagagcatcagtgaatttatt
acccctggcggtcgtctttatgagcagcgtaaccgcgcatgggaattgatcaatgatatt
ccgggcgtttcctgcgtgaaaccgcgcggtgcgctgtacatgttcccgaaaatcgacgcc
aaacgctttaatattcacgacgatcagaaaatggtgctggatttcctgttgcaggaaaaa
gttctgttggtgcaagggacggcattcaactggccgtggccggatcacttccgcattgtc
acgctaccgcgtgtcgatgatatcgagctgtctttgagcaagttcgcgcgtttcctttct
ggttatcatcagctgtaa

DBGET integrated database retrieval system