KEGG   Escherichia coli O7 K1 CE10: CE10_2672Help
Entry
CE10_2672         CDS       T01999                                 

Gene name
alaA
Definition
valine-pyruvate aminotransferase 2
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:eoc01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:eoc01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:eoc00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:eoc00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2716733..2717950
Genome map
AA seq 405 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
TPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgaaaaatccagcaaattagagaatgtctgttacgacatccgtggtccg
gtgctgaaagaagcaaaacgcctggaagaagaaggtaacaaggtactgaaactgaacatc
ggcaaccctgccccgttcggttttgacgcgccagatgaaatcctcgttgacgtgattcgc
aacctgcctaccgctcaagggtattgcgattccaaagggctttactccgcgcgtaaagcc
atcatgcagcactaccaggctcgtggcatgcgtgatgttaccgtggaagatatttacatc
ggcaatggtgtatcggagcttatcgttcaggcaatgcaggcattgctgaacagcggggac
gaaatgttggttcctgcacctgattacccactatggaccgcggcggtttcgctctccagc
ggtaaagcggtgcattatctttgcgatgaatcctctgactggttcccggaccttgatgat
attcgcgctaaaattacgcctcgtacgcgtgggatcgttattatcaacccaaataaccca
actggcgcggtatattccaaagagcttttaatggagatagtggagattgcacgtcagcat
aatctcattatcttcgccgatgaaatttatgacaaaattctctacgacgacgctgagcat
cactcaattgcgccgctggcacctgatctgctgaccattacctttaacggactgtcgaaa
acgtaccgcgttgcaggcttccgtcaggggtggatggtgttgaacgggccgaaaaaacac
gccaaaggctacatcgaaggtctggaaatgctggcttcaatgcgcctgtgtgctaacgtt
cctgcgcaacacgccattcagaccgcgctgggcggttatcagagcatcagtgaatttatt
acccctggcggtcgtctttatgagcagcgtaaccgcgcatgggaattgatcaatgatatt
ccgggcgtttcctgcgtgaaaccgcgcggtgcgctgtacatgttcccgaaaatcgacgcc
aaacgctttaatattcacgacgatcagaaaatggtgctggatttcctgttgcaggaaaaa
gttctgttggtgcaagggacggcattcaactggccgtggccggatcacttccgcattgtc
acgctaccgcgtgtcgatgatatcgagctgtctttgagcaagttcgcgcgtttcctttct
ggttatcatcagctgtaa

DBGET integrated database retrieval system